Cla97C06G117610 (gene) Watermelon (97103) v2
The following sequences are available for this feature:
Legend: polypeptideexonCDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGCTGTGATGGTACTCTCTGTACTAGCGGCTGTTTCCTTCTTCATTTTTCTTCACCTGTTCGAATCGCTGTTCTTGAAGCCGAAAAGACTTAGATCGAAGCTCCGTAAGCAAGGAATCGACGGTCCTTCGCCTTCTTTCCTCCTCGGAAATCTCCCGGAAATCAAGAACATCAGAGCAATAAAATCGCATGCCCTAACCACTACTGAAGGAGATGATTCCATTGCTCATGTCATTGAAAGTTTAGGAAGCGTGTGA ATGGCTGTGATGGTACTCTCTGTACTAGCGGCTGTTTCCTTCTTCATTTTTCTTCACCTGTTCGAATCGCTGTTCTTGAAGCCGAAAAGACTTAGATCGAAGCTCCGTAAGCAAGGAATCGACGGTCCTTCGCCTTCTTTCCTCCTCGGAAATCTCCCGGAAATCAAGAACATCAGAGCAATAAAATCGCATGCCCTAACCACTACTGAAGGAGATGATTCCATTGCTCATGTCATTGAAAGTTTAGGAAGCGTGTGA ATGGCTGTGATGGTACTCTCTGTACTAGCGGCTGTTTCCTTCTTCATTTTTCTTCACCTGTTCGAATCGCTGTTCTTGAAGCCGAAAAGACTTAGATCGAAGCTCCGTAAGCAAGGAATCGACGGTCCTTCGCCTTCTTTCCTCCTCGGAAATCTCCCGGAAATCAAGAACATCAGAGCAATAAAATCGCATGCCCTAACCACTACTGAAGGAGATGATTCCATTGCTCATGTCATTGAAAGTTTAGGAAGCGTGTGA MAVMVLSVLAAVSFFIFLHLFESLFLKPKRLRSKLRKQGIDGPSPSFLLGNLPEIKNIRAIKSHALTTTEGDDSIAHVIESLGSV
BLAST of Cla97C06G117610 vs. NCBI nr
Match: KGN61484.1 (hypothetical protein Csa_2G139860 [Cucumis sativus]) HSP 1 Score: 106.3 bits (264), Expect = 5.2e-20 Identity = 55/76 (72.37%), Postives = 65/76 (85.53%), Query Frame = 0
BLAST of Cla97C06G117610 vs. NCBI nr
Match: XP_004139011.2 (PREDICTED: cytochrome P450 714C2-like [Cucumis sativus]) HSP 1 Score: 106.3 bits (264), Expect = 5.2e-20 Identity = 55/76 (72.37%), Postives = 65/76 (85.53%), Query Frame = 0
BLAST of Cla97C06G117610 vs. NCBI nr
Match: XP_016902075.1 (PREDICTED: cytochrome P450 714C2-like [Cucumis melo]) HSP 1 Score: 100.9 bits (250), Expect = 2.2e-18 Identity = 52/76 (68.42%), Postives = 64/76 (84.21%), Query Frame = 0
BLAST of Cla97C06G117610 vs. NCBI nr
Match: XP_008457160.1 (PREDICTED: cytochrome P450 714C2-like [Cucumis melo]) HSP 1 Score: 88.6 bits (218), Expect = 1.1e-14 Identity = 50/77 (64.94%), Postives = 58/77 (75.32%), Query Frame = 0
BLAST of Cla97C06G117610 vs. NCBI nr
Match: XP_023005981.1 (cytochrome P450 714C2-like [Cucurbita maxima]) HSP 1 Score: 87.0 bits (214), Expect = 3.3e-14 Identity = 47/76 (61.84%), Postives = 57/76 (75.00%), Query Frame = 0
BLAST of Cla97C06G117610 vs. TrEMBL
Match: tr|A0A0A0LKC2|A0A0A0LKC2_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_2G139860 PE=4 SV=1) HSP 1 Score: 106.3 bits (264), Expect = 3.4e-20 Identity = 55/76 (72.37%), Postives = 65/76 (85.53%), Query Frame = 0
BLAST of Cla97C06G117610 vs. TrEMBL
Match: tr|A0A1S4E273|A0A1S4E273_CUCME (cytochrome P450 714C2-like OS=Cucumis melo OX=3656 GN=LOC103496956 PE=3 SV=1) HSP 1 Score: 100.9 bits (250), Expect = 1.4e-18 Identity = 52/76 (68.42%), Postives = 64/76 (84.21%), Query Frame = 0
BLAST of Cla97C06G117610 vs. TrEMBL
Match: tr|A0A1S3C4Y4|A0A1S3C4Y4_CUCME (cytochrome P450 714C2-like OS=Cucumis melo OX=3656 GN=LOC103496900 PE=3 SV=1) HSP 1 Score: 88.6 bits (218), Expect = 7.4e-15 Identity = 50/77 (64.94%), Postives = 58/77 (75.32%), Query Frame = 0
BLAST of Cla97C06G117610 vs. TrEMBL
Match: tr|A0A0A0LI16|A0A0A0LI16_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_2G120940 PE=3 SV=1) HSP 1 Score: 80.5 bits (197), Expect = 2.0e-12 Identity = 44/77 (57.14%), Postives = 57/77 (74.03%), Query Frame = 0
BLAST of Cla97C06G117610 vs. TrEMBL
Match: tr|M5X847|M5X847_PRUPE (Uncharacterized protein OS=Prunus persica OX=3760 GN=PRUPE_2G119500 PE=3 SV=1) HSP 1 Score: 70.5 bits (171), Expect = 2.1e-09 Identity = 45/83 (54.22%), Postives = 58/83 (69.88%), Query Frame = 0
BLAST of Cla97C06G117610 vs. Swiss-Prot
Match: sp|Q2QYH7|C14C2_ORYSJ (Cytochrome P450 714C2 OS=Oryza sativa subsp. japonica OX=39947 GN=CYP714C2 PE=2 SV=1) HSP 1 Score: 57.4 bits (137), Expect = 9.1e-08 Identity = 24/50 (48.00%), Postives = 37/50 (74.00%), Query Frame = 0
BLAST of Cla97C06G117610 vs. Swiss-Prot
Match: sp|Q7XHW5|C14B1_ORYSJ (Cytochrome P450 714B1 OS=Oryza sativa subsp. japonica OX=39947 GN=CYP714B1 PE=1 SV=2) HSP 1 Score: 50.4 bits (119), Expect = 1.1e-05 Identity = 24/53 (45.28%), Postives = 36/53 (67.92%), Query Frame = 0
BLAST of Cla97C06G117610 vs. Swiss-Prot
Match: sp|B9GBJ9|C14C1_ORYSJ (Cytochrome P450 714C1 OS=Oryza sativa subsp. japonica OX=39947 GN=CYP714C1 PE=2 SV=1) HSP 1 Score: 48.9 bits (115), Expect = 3.2e-05 Identity = 26/57 (45.61%), Postives = 39/57 (68.42%), Query Frame = 0
BLAST of Cla97C06G117610 vs. Swiss-Prot
Match: sp|B9G934|C14C3_ORYSJ (Cytochrome P450 714C3 OS=Oryza sativa subsp. japonica OX=39947 GN=CYP714C3 PE=3 SV=2) HSP 1 Score: 48.9 bits (115), Expect = 3.2e-05 Identity = 26/57 (45.61%), Postives = 39/57 (68.42%), Query Frame = 0
BLAST of Cla97C06G117610 vs. TAIR10
Match: AT5G52400.1 (cytochrome P450, family 715, subfamily A, polypeptide 1) HSP 1 Score: 42.4 bits (98), Expect = 1.7e-04 Identity = 26/75 (34.67%), Postives = 40/75 (53.33%), Query Frame = 0
BLAST of Cla97C06G117610 vs. TAIR10
Match: AT5G24900.1 (cytochrome P450, family 714, subfamily A, polypeptide 2) HSP 1 Score: 40.0 bits (92), Expect = 8.3e-04 Identity = 20/64 (31.25%), Postives = 35/64 (54.69%), Query Frame = 0
The following BLAST results are available for this feature:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of watermelon 97103 v2
Date Performed: 2019-05-12
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene: |