Cla010543 (gene) Watermelon (97103) v1
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGCTGTGATGGTACTCTCTGTACTAGCGGCTGTTTCCTTCTTCATTTTTCTTCACCTGTTCGAATCGCTGTTCTTGAAGCCGAAAAGACTTAGATCGAAGCTCCGTAAGCAAGGAATCGACGGTCCTTCGCCTTCTTTCCTCCTCGGAAATCTCCCGGAAATCAAGAACATCAGAGCAATAAAATCGCATGCCCTAACCACTACTGAAGGAGATGATTCCATTGCTCATGTCATTGAAAGTTTAGGAAGCGTGTGA ATGGCTGTGATGGTACTCTCTGTACTAGCGGCTGTTTCCTTCTTCATTTTTCTTCACCTGTTCGAATCGCTGTTCTTGAAGCCGAAAAGACTTAGATCGAAGCTCCGTAAGCAAGGAATCGACGGTCCTTCGCCTTCTTTCCTCCTCGGAAATCTCCCGGAAATCAAGAACATCAGAGCAATAAAATCGCATGCCCTAACCACTACTGAAGGAGATGATTCCATTGCTCATGTCATTGAAAGTTTAGGAAGCGTGTGA ATGGCTGTGATGGTACTCTCTGTACTAGCGGCTGTTTCCTTCTTCATTTTTCTTCACCTGTTCGAATCGCTGTTCTTGAAGCCGAAAAGACTTAGATCGAAGCTCCGTAAGCAAGGAATCGACGGTCCTTCGCCTTCTTTCCTCCTCGGAAATCTCCCGGAAATCAAGAACATCAGAGCAATAAAATCGCATGCCCTAACCACTACTGAAGGAGATGATTCCATTGCTCATGTCATTGAAAGTTTAGGAAGCGTGTGA MAVMVLSVLAAVSFFIFLHLFESLFLKPKRLRSKLRKQGIDGPSPSFLLGNLPEIKNIRAIKSHALTTTEGDDSIAHVIESLGSV
BLAST of Cla010543 vs. Swiss-Prot
Match: C14C2_ORYSJ (Cytochrome P450 714C2 OS=Oryza sativa subsp. japonica GN=CYP714C2 PE=2 SV=1) HSP 1 Score: 57.4 bits (137), Expect = 8.9e-08 Identity = 24/50 (48.00%), Postives = 35/50 (70.00%), Query Frame = 1
BLAST of Cla010543 vs. Swiss-Prot
Match: C14B1_ORYSJ (Cytochrome P450 714B1 OS=Oryza sativa subsp. japonica GN=CYP714B1 PE=1 SV=2) HSP 1 Score: 54.7 bits (130), Expect = 5.8e-07 Identity = 30/73 (41.10%), Postives = 44/73 (60.27%), Query Frame = 1
BLAST of Cla010543 vs. Swiss-Prot
Match: C14C1_ORYSJ (Cytochrome P450 714C1 OS=Oryza sativa subsp. japonica GN=CYP714C1 PE=2 SV=1) HSP 1 Score: 51.6 bits (122), Expect = 4.9e-06 Identity = 26/57 (45.61%), Postives = 37/57 (64.91%), Query Frame = 1
BLAST of Cla010543 vs. Swiss-Prot
Match: C14C3_ORYSJ (Cytochrome P450 714C3 OS=Oryza sativa subsp. japonica GN=CYP714C3 PE=3 SV=2) HSP 1 Score: 51.6 bits (122), Expect = 4.9e-06 Identity = 26/57 (45.61%), Postives = 37/57 (64.91%), Query Frame = 1
BLAST of Cla010543 vs. TrEMBL
Match: A0A0A0LKC2_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_2G139860 PE=4 SV=1) HSP 1 Score: 109.8 bits (273), Expect = 1.7e-21 Identity = 55/76 (72.37%), Postives = 65/76 (85.53%), Query Frame = 1
BLAST of Cla010543 vs. TrEMBL
Match: A0A0A0LI16_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_2G120940 PE=3 SV=1) HSP 1 Score: 84.7 bits (208), Expect = 5.8e-14 Identity = 44/77 (57.14%), Postives = 57/77 (74.03%), Query Frame = 1
BLAST of Cla010543 vs. TrEMBL
Match: M5X847_PRUPE (Uncharacterized protein OS=Prunus persica GN=PRUPE_ppa004149mg PE=3 SV=1) HSP 1 Score: 74.3 bits (181), Expect = 7.9e-11 Identity = 45/83 (54.22%), Postives = 58/83 (69.88%), Query Frame = 1
BLAST of Cla010543 vs. TrEMBL
Match: D7SM22_VITVI (Putative uncharacterized protein OS=Vitis vinifera GN=VIT_15s0021g01040 PE=3 SV=1) HSP 1 Score: 72.4 bits (176), Expect = 3.0e-10 Identity = 37/74 (50.00%), Postives = 53/74 (71.62%), Query Frame = 1
BLAST of Cla010543 vs. TrEMBL
Match: A5BFU8_VITVI (Putative uncharacterized protein OS=Vitis vinifera GN=VITISV_002447 PE=3 SV=1) HSP 1 Score: 72.4 bits (176), Expect = 3.0e-10 Identity = 37/74 (50.00%), Postives = 53/74 (71.62%), Query Frame = 1
BLAST of Cla010543 vs. NCBI nr
Match: gi|778668469|ref|XP_004139011.2| (PREDICTED: cytochrome P450 714C2-like [Cucumis sativus]) HSP 1 Score: 109.8 bits (273), Expect = 2.4e-21 Identity = 55/76 (72.37%), Postives = 65/76 (85.53%), Query Frame = 1
BLAST of Cla010543 vs. NCBI nr
Match: gi|700206365|gb|KGN61484.1| (hypothetical protein Csa_2G139860 [Cucumis sativus]) HSP 1 Score: 109.8 bits (273), Expect = 2.4e-21 Identity = 55/76 (72.37%), Postives = 65/76 (85.53%), Query Frame = 1
BLAST of Cla010543 vs. NCBI nr
Match: gi|659114787|ref|XP_008457227.1| (PREDICTED: cytochrome P450 714C2-like [Cucumis melo]) HSP 1 Score: 104.4 bits (259), Expect = 1.0e-19 Identity = 52/76 (68.42%), Postives = 64/76 (84.21%), Query Frame = 1
BLAST of Cla010543 vs. NCBI nr
Match: gi|659114644|ref|XP_008457160.1| (PREDICTED: cytochrome P450 714C2-like [Cucumis melo]) HSP 1 Score: 92.8 bits (229), Expect = 3.1e-16 Identity = 50/77 (64.94%), Postives = 58/77 (75.32%), Query Frame = 1
BLAST of Cla010543 vs. NCBI nr
Match: gi|449442331|ref|XP_004138935.1| (PREDICTED: cytochrome P450 714C2-like [Cucumis sativus]) HSP 1 Score: 84.7 bits (208), Expect = 8.3e-14 Identity = 44/77 (57.14%), Postives = 57/77 (74.03%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
This gene is associated with the following unigenes:
Analysis Name: InterPro Annotations of watermelon (97103)
Date Performed: 2016-09-28
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|