Cla97C06G114700 (gene) Watermelon (97103) v2
The following sequences are available for this feature:
Legend: polypeptideCDSexon Hold the cursor over a type above to highlight its positions in the sequence below.ATGGCTTTGGAAATAATTATAGCTTCAGCCACATGCCTTACTACAATTGGCCATACTCCCAACATGAAAATATACGTCGTCGTTTCAATCACCGGCGCCACCGTCAACCAGCAGATCAAGGCTCAGACTGACGTGGACCGACACGGCGGCAGAAATCCTACGTGGAACTTTCCGGTGAAATTTGACGCGGACGATTTAAAACAGGATGTCAAAGCTCGTCTTGTTTCGCTCTTAAGTGCGAGGATGGGAAGGGAAATAAAGATTTAG ATGGCTTTGGAAATAATTATAGCTTCAGCCACATGCCTTACTACAATTGGCCATACTCCCAACATGAAAATATACGTCGTCGTTTCAATCACCGGCGCCACCGTCAACCAGCAGATCAAGGCTCAGACTGACGTGGACCGACACGGCGGCAGAAATCCTACGTGGAACTTTCCGGTGAAATTTGACGCGGACGATTTAAAACAGGATGTCAAAGCTCGTCTTGTTTCGCTCTTAAGTGCGAGGATGGGAAGGGAAATAAAGATTTAG ATGGCTTTGGAAATAATTATAGCTTCAGCCACATGCCTTACTACAATTGGCCATACTCCCAACATGAAAATATACGTCGTCGTTTCAATCACCGGCGCCACCGTCAACCAGCAGATCAAGGCTCAGACTGACGTGGACCGACACGGCGGCAGAAATCCTACGTGGAACTTTCCGGTGAAATTTGACGCGGACGATTTAAAACAGGATGTCAAAGCTCGTCTTGTTTCGCTCTTAAGTGCGAGGATGGGAAGGGAAATAAAGATTTAG MALEIIIASATCLTTIGHTPNMKIYVVVSITGATVNQQIKAQTDVDRHGGRNPTWNFPVKFDADDLKQDVKARLVSLLSARMGREIKI
BLAST of Cla97C06G114700 vs. NCBI nr
Match: XP_008458461.1 (PREDICTED: protein SRC2-like [Cucumis melo]) HSP 1 Score: 112.5 bits (280), Expect = 7.5e-22 Identity = 55/78 (70.51%), Postives = 63/78 (80.77%), Query Frame = 0
BLAST of Cla97C06G114700 vs. NCBI nr
Match: XP_022930477.1 (protein SRC2-like [Cucurbita moschata]) HSP 1 Score: 75.1 bits (183), Expect = 1.3e-10 Identity = 44/86 (51.16%), Postives = 55/86 (63.95%), Query Frame = 0
BLAST of Cla97C06G114700 vs. NCBI nr
Match: XP_023000192.1 (protein SRC2-like [Cucurbita maxima]) HSP 1 Score: 71.6 bits (174), Expect = 1.5e-09 Identity = 44/86 (51.16%), Postives = 54/86 (62.79%), Query Frame = 0
BLAST of Cla97C06G114700 vs. NCBI nr
Match: XP_023514438.1 (protein SRC2-like [Cucurbita pepo subsp. pepo]) HSP 1 Score: 71.6 bits (174), Expect = 1.5e-09 Identity = 43/86 (50.00%), Postives = 54/86 (62.79%), Query Frame = 0
BLAST of Cla97C06G114700 vs. NCBI nr
Match: XP_023514436.1 (protein SRC2-like [Cucurbita pepo subsp. pepo]) HSP 1 Score: 71.6 bits (174), Expect = 1.5e-09 Identity = 43/86 (50.00%), Postives = 54/86 (62.79%), Query Frame = 0
BLAST of Cla97C06G114700 vs. TrEMBL
Match: tr|A0A1S3C7E6|A0A1S3C7E6_CUCME (protein SRC2-like OS=Cucumis melo OX=3656 GN=LOC103497863 PE=4 SV=1) HSP 1 Score: 112.5 bits (280), Expect = 5.0e-22 Identity = 55/78 (70.51%), Postives = 63/78 (80.77%), Query Frame = 0
BLAST of Cla97C06G114700 vs. TrEMBL
Match: tr|A0A2N9IAP9|A0A2N9IAP9_FAGSY (Uncharacterized protein OS=Fagus sylvatica OX=28930 GN=FSB_LOCUS49360 PE=4 SV=1) HSP 1 Score: 63.2 bits (152), Expect = 3.5e-07 Identity = 31/63 (49.21%), Postives = 44/63 (69.84%), Query Frame = 0
BLAST of Cla97C06G114700 vs. TrEMBL
Match: tr|A0A0A0KEB7|A0A0A0KEB7_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_6G194680 PE=4 SV=1) HSP 1 Score: 61.6 bits (148), Expect = 1.0e-06 Identity = 36/78 (46.15%), Postives = 50/78 (64.10%), Query Frame = 0
BLAST of Cla97C06G114700 vs. TrEMBL
Match: tr|A0A2P5ES55|A0A2P5ES55_9ROSA (C2 domain containing protein OS=Trema orientalis OX=63057 GN=TorRG33x02_158920 PE=4 SV=1) HSP 1 Score: 60.5 bits (145), Expect = 2.2e-06 Identity = 32/64 (50.00%), Postives = 41/64 (64.06%), Query Frame = 0
BLAST of Cla97C06G114700 vs. TrEMBL
Match: tr|B9HSC2|B9HSC2_POPTR (Uncharacterized protein OS=Populus trichocarpa OX=3694 GN=POPTR_010G024200v3 PE=4 SV=1) HSP 1 Score: 59.7 bits (143), Expect = 3.8e-06 Identity = 31/61 (50.82%), Postives = 39/61 (63.93%), Query Frame = 0
BLAST of Cla97C06G114700 vs. Swiss-Prot
Match: sp|O04133|SRC2_SOYBN (Protein SRC2 OS=Glycine max OX=3847 GN=SRC2 PE=2 SV=1) HSP 1 Score: 45.8 bits (107), Expect = 2.8e-04 Identity = 28/81 (34.57%), Postives = 45/81 (55.56%), Query Frame = 0
BLAST of Cla97C06G114700 vs. TAIR10
Match: AT4G15755.1 (Calcium-dependent lipid-binding (CaLB domain) family protein) HSP 1 Score: 53.9 bits (128), Expect = 5.8e-08 Identity = 25/65 (38.46%), Postives = 38/65 (58.46%), Query Frame = 0
The following BLAST results are available for this feature:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of watermelon 97103 v2
Date Performed: 2019-05-12
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene: |