Cla97C05G098600 (gene) Watermelon (97103) v2
The following sequences are available for this feature:
Legend: polypeptideexonCDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGCTGATGAACACCACCAATCACAGCCACCGTCCTCGCCGTCACCGCCGCTCCCTGGAGGTGGAAGAAAAGATTCAGCGAAACAACAAGAAGAAGAAGAAGTCAATCCAGAAACCAAATCCAAATCTACAGTCCGGTGTAAGAACAACACCTTTTTCGGCAGACATAGAATCTCAGCAGCCATAACTAGACTCCAAATTGAAATCAATATCATCAAGGTAATCGCTATTTCATTTTATGATTCACAGATTTACCTTAATCGCCATCGCTCTGATGATAAATCGTAATGATGCAGGAAGAATTGCAACAGCTCGAGAACATAGGTGAAGCCTCTACAGTCTGCGCAGGGTAAGAAGATTAATCAAATTCATTAGGGTTTCAAAATTCTTCAAATCGTTTAGAATCATCGTCTCCACTTCTCTAGGGCTTAATTTTCTTTCTTTACCTATTTACGTACAGATTCGTCTCCAGCGTTGAATCGATTCCAGATCCTTTGCTTCCAGAGTAAGATTATATCGCCATTAACAATAGCTATCGATCTTAGAATATAAATGAGAATTTCTTGGCCTAATCAACGAAGAATCGTTGAAAATACACAGAACAATCGGTCCGACGGACGTGAACTGGGACCAGTGGTTCCGAGGAGCTCACGGCGGTCGCAACCACAGACGGTGGATCTGA ATGGCTGATGAACACCACCAATCACAGCCACCGTCCTCGCCGTCACCGCCGCTCCCTGGAGGTGGAAGAAAAGATTCAGCGAAACAACAAGAAGAAGAAGAAGTCAATCCAGAAACCAAATCCAAATCTACAGTCCGGTGTAAGAACAACACCTTTTTCGGCAGACATAGAATCTCAGCAGCCATAACTAGACTCCAAATTGAAATCAATATCATCAAGGAAGAATTGCAACAGCTCGAGAACATAGGTGAAGCCTCTACAGTCTGCGCAGGATTCGTCTCCAGCGTTGAATCGATTCCAGATCCTTTGCTTCCAGAAACAATCGGTCCGACGGACGTGAACTGGGACCAGTGGTTCCGAGGAGCTCACGGCGGTCGCAACCACAGACGGTGGATCTGA ATGGCTGATGAACACCACCAATCACAGCCACCGTCCTCGCCGTCACCGCCGCTCCCTGGAGGTGGAAGAAAAGATTCAGCGAAACAACAAGAAGAAGAAGAAGTCAATCCAGAAACCAAATCCAAATCTACAGTCCGGTGTAAGAACAACACCTTTTTCGGCAGACATAGAATCTCAGCAGCCATAACTAGACTCCAAATTGAAATCAATATCATCAAGGAAGAATTGCAACAGCTCGAGAACATAGGTGAAGCCTCTACAGTCTGCGCAGGATTCGTCTCCAGCGTTGAATCGATTCCAGATCCTTTGCTTCCAGAAACAATCGGTCCGACGGACGTGAACTGGGACCAGTGGTTCCGAGGAGCTCACGGCGGTCGCAACCACAGACGGTGGATCTGA MADEHHQSQPPSSPSPPLPGGGRKDSAKQQEEEEVNPETKSKSTVRCKNNTFFGRHRISAAITRLQIEINIIKEELQQLENIGEASTVCAGFVSSVESIPDPLLPETIGPTDVNWDQWFRGAHGGRNHRRWI
BLAST of Cla97C05G098600 vs. NCBI nr
Match: XP_004136323.1 (PREDICTED: guanine nucleotide-binding protein subunit gamma 2-like [Cucumis sativus] >KGN60151.1 hypothetical protein Csa_3G881640 [Cucumis sativus]) HSP 1 Score: 177.9 bits (450), Expect = 2.2e-41 Identity = 83/91 (91.21%), Postives = 86/91 (94.51%), Query Frame = 0
BLAST of Cla97C05G098600 vs. NCBI nr
Match: XP_022937378.1 (guanine nucleotide-binding protein subunit gamma 2-like [Cucurbita moschata]) HSP 1 Score: 172.9 bits (437), Expect = 7.0e-40 Identity = 84/97 (86.60%), Postives = 89/97 (91.75%), Query Frame = 0
BLAST of Cla97C05G098600 vs. NCBI nr
Match: XP_023536636.1 (guanine nucleotide-binding protein subunit gamma 2-like [Cucurbita pepo subsp. pepo]) HSP 1 Score: 172.9 bits (437), Expect = 7.0e-40 Identity = 84/97 (86.60%), Postives = 89/97 (91.75%), Query Frame = 0
BLAST of Cla97C05G098600 vs. NCBI nr
Match: XP_008466337.1 (PREDICTED: guanine nucleotide-binding protein subunit gamma 2-like [Cucumis melo]) HSP 1 Score: 170.2 bits (430), Expect = 4.6e-39 Identity = 79/85 (92.94%), Postives = 82/85 (96.47%), Query Frame = 0
BLAST of Cla97C05G098600 vs. NCBI nr
Match: XP_022976216.1 (guanine nucleotide-binding protein subunit gamma 2-like [Cucurbita maxima]) HSP 1 Score: 169.1 bits (427), Expect = 1.0e-38 Identity = 83/97 (85.57%), Postives = 88/97 (90.72%), Query Frame = 0
BLAST of Cla97C05G098600 vs. TrEMBL
Match: tr|A0A0A0LJE8|A0A0A0LJE8_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_3G881640 PE=4 SV=1) HSP 1 Score: 177.9 bits (450), Expect = 1.4e-41 Identity = 83/91 (91.21%), Postives = 86/91 (94.51%), Query Frame = 0
BLAST of Cla97C05G098600 vs. TrEMBL
Match: tr|A0A1S3CR73|A0A1S3CR73_CUCME (guanine nucleotide-binding protein subunit gamma 2-like OS=Cucumis melo OX=3656 GN=LOC103503775 PE=4 SV=1) HSP 1 Score: 170.2 bits (430), Expect = 3.0e-39 Identity = 79/85 (92.94%), Postives = 82/85 (96.47%), Query Frame = 0
BLAST of Cla97C05G098600 vs. TrEMBL
Match: tr|A0A2I4E1U0|A0A2I4E1U0_9ROSI (guanine nucleotide-binding protein subunit gamma 2-like isoform X2 OS=Juglans regia OX=51240 GN=LOC108985495 PE=4 SV=1) HSP 1 Score: 122.5 bits (306), Expect = 7.2e-25 Identity = 50/81 (61.73%), Postives = 68/81 (83.95%), Query Frame = 0
BLAST of Cla97C05G098600 vs. TrEMBL
Match: tr|A0A2P4MHC0|A0A2P4MHC0_QUESU (Guanine nucleotide-binding protein subunit gamma 2 OS=Quercus suber OX=58331 GN=CFP56_17188 PE=4 SV=1) HSP 1 Score: 120.9 bits (302), Expect = 2.1e-24 Identity = 54/95 (56.84%), Postives = 70/95 (73.68%), Query Frame = 0
BLAST of Cla97C05G098600 vs. TrEMBL
Match: tr|A0A2P5G187|A0A2P5G187_9ROSA (G-protein gamma-like domain containing protein OS=Trema orientalis OX=63057 GN=TorRG33x02_000990 PE=4 SV=1) HSP 1 Score: 119.4 bits (298), Expect = 6.1e-24 Identity = 56/96 (58.33%), Postives = 73/96 (76.04%), Query Frame = 0
BLAST of Cla97C05G098600 vs. Swiss-Prot
Match: sp|Q93V47|GG2_ARATH (Guanine nucleotide-binding protein subunit gamma 2 OS=Arabidopsis thaliana OX=3702 GN=GG2 PE=1 SV=1) HSP 1 Score: 84.7 bits (208), Expect = 8.2e-16 Identity = 37/68 (54.41%), Postives = 47/68 (69.12%), Query Frame = 0
BLAST of Cla97C05G098600 vs. Swiss-Prot
Match: sp|A2X0N9|GG2_ORYSI (Guanine nucleotide-binding protein subunit gamma 2 OS=Oryza sativa subsp. indica OX=39946 GN=RGG2 PE=2 SV=1) HSP 1 Score: 82.0 bits (201), Expect = 5.3e-15 Identity = 34/80 (42.50%), Postives = 53/80 (66.25%), Query Frame = 0
BLAST of Cla97C05G098600 vs. Swiss-Prot
Match: sp|Q6YXX9|GG2_ORYSJ (Guanine nucleotide-binding protein subunit gamma 2 OS=Oryza sativa subsp. japonica OX=39947 GN=RGG2 PE=1 SV=1) HSP 1 Score: 82.0 bits (201), Expect = 5.3e-15 Identity = 34/80 (42.50%), Postives = 53/80 (66.25%), Query Frame = 0
BLAST of Cla97C05G098600 vs. Swiss-Prot
Match: sp|Q9FDX9|GG1_ARATH (Guanine nucleotide-binding protein subunit gamma 1 OS=Arabidopsis thaliana OX=3702 GN=GG1 PE=1 SV=1) HSP 1 Score: 78.2 bits (191), Expect = 7.7e-14 Identity = 34/76 (44.74%), Postives = 51/76 (67.11%), Query Frame = 0
BLAST of Cla97C05G098600 vs. Swiss-Prot
Match: sp|B8AN27|GG1_ORYSI (Guanine nucleotide-binding protein subunit gamma 1 OS=Oryza sativa subsp. indica OX=39946 GN=RGG1 PE=3 SV=1) HSP 1 Score: 65.5 bits (158), Expect = 5.2e-10 Identity = 30/78 (38.46%), Postives = 44/78 (56.41%), Query Frame = 0
BLAST of Cla97C05G098600 vs. TAIR10
Match: AT3G22942.1 (G-protein gamma subunit 2) HSP 1 Score: 84.7 bits (208), Expect = 4.6e-17 Identity = 37/68 (54.41%), Postives = 47/68 (69.12%), Query Frame = 0
BLAST of Cla97C05G098600 vs. TAIR10
Match: AT3G63420.1 (Ggamma-subunit 1) HSP 1 Score: 78.2 bits (191), Expect = 4.3e-15 Identity = 34/76 (44.74%), Postives = 51/76 (67.11%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of watermelon 97103 v2
Date Performed: 2019-05-12
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|