Cla97C05G083370 (gene) Watermelon (97103) v2
The following sequences are available for this feature:
Legend: polypeptideexonCDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGTACATGAGACCATTTGTTTTAGATGTTTATTTTTCAAGGAGGTTCATCCATGCCAAAGTGATGCATCGAGGAACAAGCAAGGTTGTTTCGGCAGCAAGCACTAATTGCAAGGATTTAAGGTATTCATTACCATCACCAACTGATGACAATGCCTGTAGGATTATTGGGAACCTAATTGCTGAGAGATGTAAAGAAGCCGATGTGTTTGTACTGTCTTATGACCCTCCAAACATGGAAAGAATTCAAGGCAAAATTGGGATTGTAATTGATACTATTAAGGAGAATGGTATTCTATTCGTCTAG ATGTACATGAGACCATTTGTTTTAGATGTTTATTTTTCAAGGAGGTTCATCCATGCCAAAGTGATGCATCGAGGAACAAGCAAGGTTGTTTCGGCAGCAAGCACTAATTGCAAGGATTTAAGGTATTCATTACCATCACCAACTGATGACAATGCCTGTAGGATTATTGGGAACCTAATTGCTGAGAGATGTAAAGAAGCCGATGTGTTTGTACTGTCTTATGACCCTCCAAACATGGAAAGAATTCAAGGCAAAATTGGGATTGTAATTGATACTATTAAGGAGAATGGTATTCTATTCGTCTAG ATGTACATGAGACCATTTGTTTTAGATGTTTATTTTTCAAGGAGGTTCATCCATGCCAAAGTGATGCATCGAGGAACAAGCAAGGTTGTTTCGGCAGCAAGCACTAATTGCAAGGATTTAAGGTATTCATTACCATCACCAACTGATGACAATGCCTGTAGGATTATTGGGAACCTAATTGCTGAGAGATGTAAAGAAGCCGATGTGTTTGTACTGTCTTATGACCCTCCAAACATGGAAAGAATTCAAGGCAAAATTGGGATTGTAATTGATACTATTAAGGAGAATGGTATTCTATTCGTCTAG MYMRPFVLDVYFSRRFIHAKVMHRGTSKVVSAASTNCKDLRYSLPSPTDDNACRIIGNLIAERCKEADVFVLSYDPPNMERIQGKIGIVIDTIKENGILFV
BLAST of Cla97C05G083370 vs. NCBI nr
Match: XP_011650830.1 (PREDICTED: 39S ribosomal protein L18, mitochondrial [Cucumis sativus] >KGN56667.1 hypothetical protein Csa_3G127780 [Cucumis sativus]) HSP 1 Score: 198.7 bits (504), Expect = 9.2e-48 Identity = 95/101 (94.06%), Postives = 99/101 (98.02%), Query Frame = 0
BLAST of Cla97C05G083370 vs. NCBI nr
Match: XP_008438261.1 (PREDICTED: 50S ribosomal protein L18-like [Cucumis melo]) HSP 1 Score: 197.2 bits (500), Expect = 2.7e-47 Identity = 94/101 (93.07%), Postives = 99/101 (98.02%), Query Frame = 0
BLAST of Cla97C05G083370 vs. NCBI nr
Match: XP_022937699.1 (uncharacterized protein LOC111444022 [Cucurbita moschata]) HSP 1 Score: 190.7 bits (483), Expect = 2.5e-45 Identity = 92/101 (91.09%), Postives = 96/101 (95.05%), Query Frame = 0
BLAST of Cla97C05G083370 vs. NCBI nr
Match: XP_022974777.1 (uncharacterized protein LOC111473501 [Cucurbita maxima]) HSP 1 Score: 190.7 bits (483), Expect = 2.5e-45 Identity = 92/101 (91.09%), Postives = 96/101 (95.05%), Query Frame = 0
BLAST of Cla97C05G083370 vs. NCBI nr
Match: XP_022974979.1 (uncharacterized protein LOC111473828 [Cucurbita maxima]) HSP 1 Score: 190.7 bits (483), Expect = 2.5e-45 Identity = 92/101 (91.09%), Postives = 96/101 (95.05%), Query Frame = 0
BLAST of Cla97C05G083370 vs. TrEMBL
Match: tr|A0A0A0L7S5|A0A0A0L7S5_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_3G127780 PE=4 SV=1) HSP 1 Score: 198.7 bits (504), Expect = 6.1e-48 Identity = 95/101 (94.06%), Postives = 99/101 (98.02%), Query Frame = 0
BLAST of Cla97C05G083370 vs. TrEMBL
Match: tr|A0A1S3AVM4|A0A1S3AVM4_CUCME (50S ribosomal protein L18-like OS=Cucumis melo OX=3656 GN=LOC103483425 PE=4 SV=1) HSP 1 Score: 197.2 bits (500), Expect = 1.8e-47 Identity = 94/101 (93.07%), Postives = 99/101 (98.02%), Query Frame = 0
BLAST of Cla97C05G083370 vs. TrEMBL
Match: tr|M5XKK2|M5XKK2_PRUPE (Uncharacterized protein OS=Prunus persica OX=3760 GN=PRUPE_ppa019075mg PE=4 SV=1) HSP 1 Score: 164.9 bits (416), Expect = 9.7e-38 Identity = 76/101 (75.25%), Postives = 92/101 (91.09%), Query Frame = 0
BLAST of Cla97C05G083370 vs. TrEMBL
Match: tr|A0A251QFL7|A0A251QFL7_PRUPE (Uncharacterized protein OS=Prunus persica OX=3760 GN=PRUPE_2G113900 PE=4 SV=1) HSP 1 Score: 164.9 bits (416), Expect = 9.7e-38 Identity = 76/101 (75.25%), Postives = 92/101 (91.09%), Query Frame = 0
BLAST of Cla97C05G083370 vs. TrEMBL
Match: tr|A0A2P4N683|A0A2P4N683_QUESU (50s ribosomal protein l18 OS=Quercus suber OX=58331 GN=CFP56_48308 PE=4 SV=1) HSP 1 Score: 163.7 bits (413), Expect = 2.2e-37 Identity = 77/101 (76.24%), Postives = 91/101 (90.10%), Query Frame = 0
BLAST of Cla97C05G083370 vs. Swiss-Prot
Match: sp|Q5P316|RL18_AROAE (50S ribosomal protein L18 OS=Aromatoleum aromaticum (strain EbN1) OX=76114 GN=rplR PE=3 SV=1) HSP 1 Score: 54.7 bits (130), Expect = 7.0e-07 Identity = 30/93 (32.26%), Postives = 54/93 (58.06%), Query Frame = 0
BLAST of Cla97C05G083370 vs. Swiss-Prot
Match: sp|B5ZYV1|RL18_RHILW (50S ribosomal protein L18 OS=Rhizobium leguminosarum bv. trifolii (strain WSM2304) OX=395492 GN=rplR PE=3 SV=1) HSP 1 Score: 52.4 bits (124), Expect = 3.5e-06 Identity = 33/93 (35.48%), Postives = 51/93 (54.84%), Query Frame = 0
BLAST of Cla97C05G083370 vs. Swiss-Prot
Match: sp|A9BG02|RL18_PETMO (50S ribosomal protein L18 OS=Petrotoga mobilis (strain DSM 10674 / SJ95) OX=403833 GN=rplR PE=3 SV=1) HSP 1 Score: 51.6 bits (122), Expect = 5.9e-06 Identity = 27/93 (29.03%), Postives = 51/93 (54.84%), Query Frame = 0
BLAST of Cla97C05G083370 vs. Swiss-Prot
Match: sp|Q11HR8|RL18_CHESB (50S ribosomal protein L18 OS=Chelativorans sp. (strain BNC1) OX=266779 GN=rplR PE=3 SV=1) HSP 1 Score: 50.8 bits (120), Expect = 1.0e-05 Identity = 31/93 (33.33%), Postives = 51/93 (54.84%), Query Frame = 0
BLAST of Cla97C05G083370 vs. Swiss-Prot
Match: sp|B0U0X3|RL18_FRAP2 (50S ribosomal protein L18 OS=Francisella philomiragia subsp. philomiragia (strain ATCC 25017) OX=484022 GN=rplR PE=3 SV=1) HSP 1 Score: 50.8 bits (120), Expect = 1.0e-05 Identity = 28/93 (30.11%), Postives = 53/93 (56.99%), Query Frame = 0
BLAST of Cla97C05G083370 vs. TAIR10
Match: AT3G20230.1 (Ribosomal L18p/L5e family protein) HSP 1 Score: 146.0 bits (367), Expect = 1.3e-35 Identity = 68/101 (67.33%), Postives = 87/101 (86.14%), Query Frame = 0
BLAST of Cla97C05G083370 vs. TAIR10
Match: AT1G08845.2 (Ribosomal L18p/L5e family protein) HSP 1 Score: 94.4 bits (233), Expect = 4.4e-20 Identity = 44/97 (45.36%), Postives = 64/97 (65.98%), Query Frame = 0
BLAST of Cla97C05G083370 vs. TAIR10
Match: AT3G22450.1 (Ribosomal L18p/L5e family protein) HSP 1 Score: 77.0 bits (188), Expect = 7.3e-15 Identity = 35/94 (37.23%), Postives = 60/94 (63.83%), Query Frame = 0
BLAST of Cla97C05G083370 vs. TAIR10
Match: AT5G27820.1 (Ribosomal L18p/L5e family protein) HSP 1 Score: 67.8 bits (164), Expect = 4.4e-12 Identity = 32/97 (32.99%), Postives = 58/97 (59.79%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of watermelon 97103 v2
Date Performed: 2019-05-12
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene: |