Cla97C02G031320 (gene) Watermelon (97103) v2
The following sequences are available for this feature:
Legend: polypeptideexonCDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGGTTTCCGTCTACCTAGAATTGTTACTGCTAAGCAAAGTCTTCAGCGATCTTCATCAACAGGGAACGGAGCATCTCCAAAGGCTGTTGATGTTCCAAAGGGATACTTTACAGTTTATGTTGGTGAGGTACAAAAGAAGCGTTTTGTCATCCCATTATCTTACTTGAACCAGCCGTCTTTTCAAGATTTGTTGAGTCAAGCAGAAGAAGAATTTGGATATAATCATCCAATGGGTGGCATCACAATTCCTTGCAGTGAAGACTATTTCCTCAATCTCACTCGGAGTTTGAATGATTAA ATGGGTTTCCGTCTACCTAGAATTGTTACTGCTAAGCAAAGTCTTCAGCGATCTTCATCAACAGGGAACGGAGCATCTCCAAAGGCTGTTGATGTTCCAAAGGGATACTTTACAGTTTATGTTGGTGAGGTACAAAAGAAGCGTTTTGTCATCCCATTATCTTACTTGAACCAGCCGTCTTTTCAAGATTTGTTGAGTCAAGCAGAAGAAGAATTTGGATATAATCATCCAATGGGTGGCATCACAATTCCTTGCAGTGAAGACTATTTCCTCAATCTCACTCGGAGTTTGAATGATTAA ATGGGTTTCCGTCTACCTAGAATTGTTACTGCTAAGCAAAGTCTTCAGCGATCTTCATCAACAGGGAACGGAGCATCTCCAAAGGCTGTTGATGTTCCAAAGGGATACTTTACAGTTTATGTTGGTGAGGTACAAAAGAAGCGTTTTGTCATCCCATTATCTTACTTGAACCAGCCGTCTTTTCAAGATTTGTTGAGTCAAGCAGAAGAAGAATTTGGATATAATCATCCAATGGGTGGCATCACAATTCCTTGCAGTGAAGACTATTTCCTCAATCTCACTCGGAGTTTGAATGATTAA MGFRLPRIVTAKQSLQRSSSTGNGASPKAVDVPKGYFTVYVGEVQKKRFVIPLSYLNQPSFQDLLSQAEEEFGYNHPMGGITIPCSEDYFLNLTRSLND
BLAST of Cla97C02G031320 vs. NCBI nr
Match: XP_022952257.1 (auxin-induced protein 15A-like [Cucurbita moschata]) HSP 1 Score: 194.9 bits (494), Expect = 1.3e-46 Identity = 94/99 (94.95%), Postives = 96/99 (96.97%), Query Frame = 0
BLAST of Cla97C02G031320 vs. NCBI nr
Match: XP_022952255.1 (auxin-induced protein X10A-like [Cucurbita moschata]) HSP 1 Score: 194.5 bits (493), Expect = 1.7e-46 Identity = 94/99 (94.95%), Postives = 96/99 (96.97%), Query Frame = 0
BLAST of Cla97C02G031320 vs. NCBI nr
Match: XP_011658575.1 (PREDICTED: auxin-induced protein 15A-like [Cucumis sativus] >KGN43202.1 hypothetical protein Csa_7G008980 [Cucumis sativus]) HSP 1 Score: 194.1 bits (492), Expect = 2.2e-46 Identity = 93/99 (93.94%), Postives = 96/99 (96.97%), Query Frame = 0
BLAST of Cla97C02G031320 vs. NCBI nr
Match: XP_023553777.1 (auxin-induced protein X10A-like [Cucurbita pepo subsp. pepo] >XP_023553882.1 auxin-induced protein X10A-like [Cucurbita pepo subsp. pepo] >XP_023554331.1 auxin-induced protein X10A-like [Cucurbita pepo subsp. pepo]) HSP 1 Score: 194.1 bits (492), Expect = 2.2e-46 Identity = 94/99 (94.95%), Postives = 95/99 (95.96%), Query Frame = 0
BLAST of Cla97C02G031320 vs. NCBI nr
Match: XP_008448014.1 (PREDICTED: auxin-induced protein 15A-like [Cucumis melo]) HSP 1 Score: 191.4 bits (485), Expect = 1.4e-45 Identity = 90/99 (90.91%), Postives = 95/99 (95.96%), Query Frame = 0
BLAST of Cla97C02G031320 vs. TrEMBL
Match: tr|A0A0A0K4J0|A0A0A0K4J0_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_7G008980 PE=4 SV=1) HSP 1 Score: 194.1 bits (492), Expect = 1.5e-46 Identity = 93/99 (93.94%), Postives = 96/99 (96.97%), Query Frame = 0
BLAST of Cla97C02G031320 vs. TrEMBL
Match: tr|A0A1S3BIR0|A0A1S3BIR0_CUCME (auxin-induced protein 15A-like OS=Cucumis melo OX=3656 GN=LOC103490324 PE=4 SV=1) HSP 1 Score: 191.4 bits (485), Expect = 9.5e-46 Identity = 90/99 (90.91%), Postives = 95/99 (95.96%), Query Frame = 0
BLAST of Cla97C02G031320 vs. TrEMBL
Match: tr|A0A0A0K5T8|A0A0A0K5T8_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_7G009020 PE=4 SV=1) HSP 1 Score: 188.7 bits (478), Expect = 6.1e-45 Identity = 91/99 (91.92%), Postives = 94/99 (94.95%), Query Frame = 0
BLAST of Cla97C02G031320 vs. TrEMBL
Match: tr|A0A0A0K0H9|A0A0A0K0H9_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_7G009010 PE=4 SV=1) HSP 1 Score: 188.3 bits (477), Expect = 8.0e-45 Identity = 89/99 (89.90%), Postives = 95/99 (95.96%), Query Frame = 0
BLAST of Cla97C02G031320 vs. TrEMBL
Match: tr|A0A0A0K160|A0A0A0K160_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_7G008990 PE=4 SV=1) HSP 1 Score: 186.4 bits (472), Expect = 3.1e-44 Identity = 89/99 (89.90%), Postives = 94/99 (94.95%), Query Frame = 0
BLAST of Cla97C02G031320 vs. Swiss-Prot
Match: sp|P33080|AX10A_SOYBN (Auxin-induced protein X10A OS=Glycine max OX=3847 PE=2 SV=1) HSP 1 Score: 128.6 bits (322), Expect = 3.7e-29 Identity = 62/99 (62.63%), Postives = 77/99 (77.78%), Query Frame = 0
BLAST of Cla97C02G031320 vs. Swiss-Prot
Match: sp|P33083|AX6B_SOYBN (Auxin-induced protein 6B OS=Glycine max OX=3847 PE=2 SV=1) HSP 1 Score: 125.6 bits (314), Expect = 3.2e-28 Identity = 63/98 (64.29%), Postives = 76/98 (77.55%), Query Frame = 0
BLAST of Cla97C02G031320 vs. Swiss-Prot
Match: sp|P32295|ARG7_VIGRR (Indole-3-acetic acid-induced protein ARG7 OS=Vigna radiata var. radiata OX=3916 GN=ARG7 PE=2 SV=1) HSP 1 Score: 122.5 bits (306), Expect = 2.7e-27 Identity = 61/98 (62.24%), Postives = 73/98 (74.49%), Query Frame = 0
BLAST of Cla97C02G031320 vs. Swiss-Prot
Match: sp|P33079|A10A5_SOYBN (Auxin-induced protein 10A5 OS=Glycine max OX=3847 PE=2 SV=1) HSP 1 Score: 120.2 bits (300), Expect = 1.3e-26 Identity = 60/99 (60.61%), Postives = 75/99 (75.76%), Query Frame = 0
BLAST of Cla97C02G031320 vs. Swiss-Prot
Match: sp|P33081|AX15A_SOYBN (Auxin-induced protein 15A OS=Glycine max OX=3847 PE=2 SV=1) HSP 1 Score: 119.8 bits (299), Expect = 1.7e-26 Identity = 63/98 (64.29%), Postives = 68/98 (69.39%), Query Frame = 0
BLAST of Cla97C02G031320 vs. TAIR10
Match: AT4G38840.1 (SAUR-like auxin-responsive protein family ) HSP 1 Score: 120.9 bits (302), Expect = 4.3e-28 Identity = 54/99 (54.55%), Postives = 75/99 (75.76%), Query Frame = 0
BLAST of Cla97C02G031320 vs. TAIR10
Match: AT5G18080.1 (SAUR-like auxin-responsive protein family ) HSP 1 Score: 112.8 bits (281), Expect = 1.2e-25 Identity = 52/90 (57.78%), Postives = 69/90 (76.67%), Query Frame = 0
BLAST of Cla97C02G031320 vs. TAIR10
Match: AT5G18010.1 (SAUR-like auxin-responsive protein family ) HSP 1 Score: 111.3 bits (277), Expect = 3.4e-25 Identity = 52/90 (57.78%), Postives = 69/90 (76.67%), Query Frame = 0
BLAST of Cla97C02G031320 vs. TAIR10
Match: AT5G18020.1 (SAUR-like auxin-responsive protein family ) HSP 1 Score: 110.2 bits (274), Expect = 7.6e-25 Identity = 50/87 (57.47%), Postives = 68/87 (78.16%), Query Frame = 0
BLAST of Cla97C02G031320 vs. TAIR10
Match: AT5G18060.1 (SAUR-like auxin-responsive protein family ) HSP 1 Score: 110.2 bits (274), Expect = 7.6e-25 Identity = 51/91 (56.04%), Postives = 69/91 (75.82%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of watermelon 97103 v2
Date Performed: 2019-05-12
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene: |