Cla97C01G011500 (gene) Watermelon (97103) v2
The following sequences are available for this feature:
Legend: polypeptideexonCDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGGTTTAAAATTCTGGCAATCACACCAGGACTTGCCTTCGCTATTCAAAAACATCCCGGTTGAGGGTTGGTTTGATGAGATGAAGAGTGGAAAAGAAGACCCAGGTCCAATTCCATTAGCTCAGAATCTATCTAACAGTTTTATACAAGTATGGAGGTGTTTACATAGATACATACTTTATTGTTTTGAAGTCTTTCATGGGGTTGAAGAACTCAATTGGCGCAAAAGCATCCACTTCTATAGGAATTCATGGAAAATTTTGCATCAAATTTTGATGGGAGTAGATGGGGATATAATGGACCTTTTCTGGTCTCCAGAGTAATAGCAAATGTAGGAGCCAGAGCTAAACCTGGTTTCAACGTCACTGTACTGCCACCATCAACGTTCTACCCAGTGAAGTGGATCAAGATTGGTGAATTTTATAAGAAGCTCAGCTAA ATGGGTTTAAAATTCTGGCAATCACACCAGGACTTGCCTTCGCTATTCAAAAACATCCCGGTTGAGGGTTGGTTTGATGAGATGAAGAGTGGAAAAGAAGACCCAGGTCCAATTCCATTAGCTCAGAATCTATCTAACAGTTTTATACAAGAATTCATGGAAAATTTTGCATCAAATTTTGATGGGAGTAGATGGGGATATAATGGACCTTTTCTGGTCTCCAGAGTAATAGCAAATGTAGGAGCCAGAGCTAAACCTGGTTTCAACGTCACTGTACTGCCACCATCAACGTTCTACCCAGTGAAGTGGATCAAGATTGGTGAATTTTATAAGAAGCTCAGCTAA ATGGGTTTAAAATTCTGGCAATCACACCAGGACTTGCCTTCGCTATTCAAAAACATCCCGGTTGAGGGTTGGTTTGATGAGATGAAGAGTGGAAAAGAAGACCCAGGTCCAATTCCATTAGCTCAGAATCTATCTAACAGTTTTATACAAGAATTCATGGAAAATTTTGCATCAAATTTTGATGGGAGTAGATGGGGATATAATGGACCTTTTCTGGTCTCCAGAGTAATAGCAAATGTAGGAGCCAGAGCTAAACCTGGTTTCAACGTCACTGTACTGCCACCATCAACGTTCTACCCAGTGAAGTGGATCAAGATTGGTGAATTTTATAAGAAGCTCAGCTAA MGLKFWQSHQDLPSLFKNIPVEGWFDEMKSGKEDPGPIPLAQNLSNSFIQEFMENFASNFDGSRWGYNGPFLVSRVIANVGARAKPGFNVTVLPPSTFYPVKWIKIGEFYKKLS
BLAST of Cla97C01G011500 vs. NCBI nr
Match: XP_004137912.1 (PREDICTED: lactosylceramide 4-alpha-galactosyltransferase [Cucumis sativus] >KGN58777.1 hypothetical protein Csa_3G731870 [Cucumis sativus]) HSP 1 Score: 157.9 bits (398), Expect = 2.0e-35 Identity = 85/170 (50.00%), Postives = 94/170 (55.29%), Query Frame = 0
BLAST of Cla97C01G011500 vs. NCBI nr
Match: XP_016899682.1 (PREDICTED: lactosylceramide 4-alpha-galactosyltransferase [Cucumis melo]) HSP 1 Score: 156.4 bits (394), Expect = 5.9e-35 Identity = 85/170 (50.00%), Postives = 93/170 (54.71%), Query Frame = 0
BLAST of Cla97C01G011500 vs. NCBI nr
Match: XP_022948708.1 (lactosylceramide 4-alpha-galactosyltransferase-like [Cucurbita moschata]) HSP 1 Score: 154.1 bits (388), Expect = 2.9e-34 Identity = 84/170 (49.41%), Postives = 92/170 (54.12%), Query Frame = 0
BLAST of Cla97C01G011500 vs. NCBI nr
Match: XP_023539712.1 (lactosylceramide 4-alpha-galactosyltransferase-like [Cucurbita pepo subsp. pepo]) HSP 1 Score: 152.9 bits (385), Expect = 6.5e-34 Identity = 83/170 (48.82%), Postives = 92/170 (54.12%), Query Frame = 0
BLAST of Cla97C01G011500 vs. NCBI nr
Match: XP_022971397.1 (lactosylceramide 4-alpha-galactosyltransferase-like isoform X2 [Cucurbita maxima]) HSP 1 Score: 151.8 bits (382), Expect = 1.4e-33 Identity = 83/170 (48.82%), Postives = 91/170 (53.53%), Query Frame = 0
BLAST of Cla97C01G011500 vs. TrEMBL
Match: tr|A0A0A0LDG3|A0A0A0LDG3_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_3G731870 PE=4 SV=1) HSP 1 Score: 157.9 bits (398), Expect = 1.3e-35 Identity = 85/170 (50.00%), Postives = 94/170 (55.29%), Query Frame = 0
BLAST of Cla97C01G011500 vs. TrEMBL
Match: tr|A0A1S4DUL6|A0A1S4DUL6_CUCME (lactosylceramide 4-alpha-galactosyltransferase OS=Cucumis melo OX=3656 GN=LOC103486309 PE=4 SV=1) HSP 1 Score: 156.4 bits (394), Expect = 3.9e-35 Identity = 85/170 (50.00%), Postives = 93/170 (54.71%), Query Frame = 0
BLAST of Cla97C01G011500 vs. TrEMBL
Match: tr|A0A2P4L5N7|A0A2P4L5N7_QUESU (Lactosylceramide 4-alpha-galactosyltransferase OS=Quercus suber OX=58331 GN=CFP56_27651 PE=4 SV=1) HSP 1 Score: 131.0 bits (328), Expect = 1.8e-27 Identity = 62/123 (50.41%), Postives = 78/123 (63.41%), Query Frame = 0
BLAST of Cla97C01G011500 vs. TrEMBL
Match: tr|A0A2N9FAN7|A0A2N9FAN7_FAGSY (Uncharacterized protein OS=Fagus sylvatica OX=28930 GN=FSB_LOCUS12057 PE=4 SV=1) HSP 1 Score: 118.6 bits (296), Expect = 9.0e-24 Identity = 65/160 (40.62%), Postives = 77/160 (48.12%), Query Frame = 0
BLAST of Cla97C01G011500 vs. TrEMBL
Match: tr|A0A251NWJ9|A0A251NWJ9_PRUPE (Uncharacterized protein OS=Prunus persica OX=3760 GN=PRUPE_6G274700 PE=4 SV=1) HSP 1 Score: 117.1 bits (292), Expect = 2.6e-23 Identity = 65/169 (38.46%), Postives = 79/169 (46.75%), Query Frame = 0
BLAST of Cla97C01G011500 vs. Swiss-Prot
Match: sp|Q67BJ4|A4GAT_MOUSE (Lactosylceramide 4-alpha-galactosyltransferase OS=Mus musculus OX=10090 GN=A4galt PE=2 SV=1) HSP 1 Score: 48.1 bits (113), Expect = 7.4e-05 Identity = 23/80 (28.75%), Postives = 42/80 (52.50%), Query Frame = 0
BLAST of Cla97C01G011500 vs. Swiss-Prot
Match: sp|Q9N289|A4GAT_PONPY (Lactosylceramide 4-alpha-galactosyltransferase (Fragment) OS=Pongo pygmaeus OX=9600 GN=A4GALT PE=3 SV=1) HSP 1 Score: 47.4 bits (111), Expect = 1.3e-04 Identity = 24/80 (30.00%), Postives = 41/80 (51.25%), Query Frame = 0
BLAST of Cla97C01G011500 vs. Swiss-Prot
Match: sp|Q9NPC4|A4GAT_HUMAN (Lactosylceramide 4-alpha-galactosyltransferase OS=Homo sapiens OX=9606 GN=A4GALT PE=2 SV=1) HSP 1 Score: 46.2 bits (108), Expect = 2.8e-04 Identity = 23/80 (28.75%), Postives = 41/80 (51.25%), Query Frame = 0
BLAST of Cla97C01G011500 vs. Swiss-Prot
Match: sp|Q9N291|A4GAT_PANTR (Lactosylceramide 4-alpha-galactosyltransferase OS=Pan troglodytes OX=9598 GN=A4GALT PE=3 SV=1) HSP 1 Score: 46.2 bits (108), Expect = 2.8e-04 Identity = 23/80 (28.75%), Postives = 41/80 (51.25%), Query Frame = 0
BLAST of Cla97C01G011500 vs. Swiss-Prot
Match: sp|Q9N290|A4GAT_GORGO (Lactosylceramide 4-alpha-galactosyltransferase (Fragment) OS=Gorilla gorilla gorilla OX=9595 GN=A4GALT PE=3 SV=1) HSP 1 Score: 45.8 bits (107), Expect = 3.7e-04 Identity = 23/80 (28.75%), Postives = 41/80 (51.25%), Query Frame = 0
BLAST of Cla97C01G011500 vs. TAIR10
Match: AT2G38150.1 (alpha 1,4-glycosyltransferase family protein) HSP 1 Score: 96.3 bits (238), Expect = 1.3e-20 Identity = 54/161 (33.54%), Postives = 72/161 (44.72%), Query Frame = 0
BLAST of Cla97C01G011500 vs. TAIR10
Match: AT2G38152.1 (alpha 1,4-glycosyltransferase family protein) HSP 1 Score: 92.4 bits (228), Expect = 1.9e-19 Identity = 55/169 (32.54%), Postives = 70/169 (41.42%), Query Frame = 0
BLAST of Cla97C01G011500 vs. TAIR10
Match: AT5G01250.1 (alpha 1,4-glycosyltransferase family protein) HSP 1 Score: 90.5 bits (223), Expect = 7.2e-19 Identity = 57/168 (33.93%), Postives = 69/168 (41.07%), Query Frame = 0
BLAST of Cla97C01G011500 vs. TAIR10
Match: AT1G61050.1 (alpha 1,4-glycosyltransferase family protein) HSP 1 Score: 87.8 bits (216), Expect = 4.7e-18 Identity = 49/168 (29.17%), Postives = 68/168 (40.48%), Query Frame = 0
BLAST of Cla97C01G011500 vs. TAIR10
Match: AT3G09020.1 (alpha 1,4-glycosyltransferase family protein) HSP 1 Score: 84.3 bits (207), Expect = 5.2e-17 Identity = 50/159 (31.45%), Postives = 68/159 (42.77%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of watermelon 97103 v2
Date Performed: 2019-05-12
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene: |