Cla97C01G009150 (gene) Watermelon (97103) v2
The following sequences are available for this feature:
Legend: polypeptideexonCDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGGATTTGATTATGCAATTTTTACTGGGACATCATTGGTTGGAGATGGGCAACTTAATTACCAAAACTTGTTTGATGCCATGTTGGACGTTGTTTACTCTACTTTGGAGAATCGTGGTGGAGGATCATTGGAGATTGTTGTATCCGGGACTGGTTGGCCAACGGATGGTGGAGAGGCGGCAACGATAGACAATGCAAGGACTTACAACAACAATCTAAGTCAACATGTGAAACAAGGGACTGCAAACAAGACAAGGAAGGGTTATTGA ATGGGATTTGATTATGCAATTTTTACTGGGACATCATTGGTTGGAGATGGGCAACTTAATTACCAAAACTTGTTTGATGCCATGTTGGACGTTGTTTACTCTACTTTGGAGAATCGTGGTGGAGGATCATTGGAGATTGTTGTATCCGGGACTGGTTGGCCAACGGATGGTGGAGAGGCGGCAACGATAGACAATGCAAGGACTTACAACAACAATCTAAGTCAACATGTGAAACAAGGGACTGCAAACAAGACAAGGAAGGGTTATTGA ATGGGATTTGATTATGCAATTTTTACTGGGACATCATTGGTTGGAGATGGGCAACTTAATTACCAAAACTTGTTTGATGCCATGTTGGACGTTGTTTACTCTACTTTGGAGAATCGTGGTGGAGGATCATTGGAGATTGTTGTATCCGGGACTGGTTGGCCAACGGATGGTGGAGAGGCGGCAACGATAGACAATGCAAGGACTTACAACAACAATCTAAGTCAACATGTGAAACAAGGGACTGCAAACAAGACAAGGAAGGGTTATTGA MGFDYAIFTGTSLVGDGQLNYQNLFDAMLDVVYSTLENRGGGSLEIVVSGTGWPTDGGEAATIDNARTYNNNLSQHVKQGTANKTRKGY
BLAST of Cla97C01G009150 vs. NCBI nr
Match: KGN65972.1 (hypothetical protein Csa_1G555080 [Cucumis sativus]) HSP 1 Score: 138.7 bits (348), Expect = 9.9e-30 Identity = 66/84 (78.57%), Postives = 72/84 (85.71%), Query Frame = 0
BLAST of Cla97C01G009150 vs. NCBI nr
Match: XP_011659353.1 (PREDICTED: glucan endo-1,3-beta-glucosidase, basic isoform-like [Cucumis sativus]) HSP 1 Score: 138.7 bits (348), Expect = 9.9e-30 Identity = 66/84 (78.57%), Postives = 72/84 (85.71%), Query Frame = 0
BLAST of Cla97C01G009150 vs. NCBI nr
Match: XP_008459107.1 (PREDICTED: glucan endo-1,3-beta-glucosidase, basic isoform-like [Cucumis melo]) HSP 1 Score: 132.1 bits (331), Expect = 9.3e-28 Identity = 65/84 (77.38%), Postives = 69/84 (82.14%), Query Frame = 0
BLAST of Cla97C01G009150 vs. NCBI nr
Match: XP_022139185.1 (glucan endo-1,3-beta-glucosidase-like [Momordica charantia]) HSP 1 Score: 125.2 bits (313), Expect = 1.1e-25 Identity = 60/84 (71.43%), Postives = 67/84 (79.76%), Query Frame = 0
BLAST of Cla97C01G009150 vs. NCBI nr
Match: BAA31142.1 (beta-1,3-glucanase, partial [Cucumis sativus]) HSP 1 Score: 120.6 bits (301), Expect = 2.8e-24 Identity = 57/73 (78.08%), Postives = 63/73 (86.30%), Query Frame = 0
BLAST of Cla97C01G009150 vs. TrEMBL
Match: tr|A0A0A0LYQ8|A0A0A0LYQ8_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_1G555080 PE=3 SV=1) HSP 1 Score: 138.7 bits (348), Expect = 6.6e-30 Identity = 66/84 (78.57%), Postives = 72/84 (85.71%), Query Frame = 0
BLAST of Cla97C01G009150 vs. TrEMBL
Match: tr|A0A1S3C9Z3|A0A1S3C9Z3_CUCME (glucan endo-1,3-beta-glucosidase, basic isoform-like OS=Cucumis melo OX=3656 GN=LOC103498316 PE=3 SV=1) HSP 1 Score: 132.1 bits (331), Expect = 6.1e-28 Identity = 65/84 (77.38%), Postives = 69/84 (82.14%), Query Frame = 0
BLAST of Cla97C01G009150 vs. TrEMBL
Match: tr|O80357|O80357_CUCSA (Beta-1,3-glucanase (Fragment) OS=Cucumis sativus OX=3659 GN=beta-1,3-glucanase PE=2 SV=1) HSP 1 Score: 120.6 bits (301), Expect = 1.8e-24 Identity = 57/73 (78.08%), Postives = 63/73 (86.30%), Query Frame = 0
BLAST of Cla97C01G009150 vs. TrEMBL
Match: tr|A0A145YQC1|A0A145YQC1_ROSRU (Beta-1,3-glucanase OS=Rosa rugosa OX=74645 GN=Glu PE=2 SV=1) HSP 1 Score: 116.3 bits (290), Expect = 3.5e-23 Identity = 59/82 (71.95%), Postives = 65/82 (79.27%), Query Frame = 0
BLAST of Cla97C01G009150 vs. TrEMBL
Match: tr|A0A2P6P1R6|A0A2P6P1R6_ROSCH (Putative glucan endo-1,3-beta-D-glucosidase OS=Rosa chinensis OX=74649 GN=RchiOBHm_Chr7g0178171 PE=3 SV=1) HSP 1 Score: 114.8 bits (286), Expect = 1.0e-22 Identity = 58/82 (70.73%), Postives = 65/82 (79.27%), Query Frame = 0
BLAST of Cla97C01G009150 vs. Swiss-Prot
Match: sp|Q9M2M0|BG1_ARATH (Probable glucan endo-1,3-beta-glucosidase BG1 OS=Arabidopsis thaliana OX=3702 GN=BG1 PE=2 SV=1) HSP 1 Score: 101.7 bits (252), Expect = 4.4e-21 Identity = 52/85 (61.18%), Postives = 60/85 (70.59%), Query Frame = 0
BLAST of Cla97C01G009150 vs. Swiss-Prot
Match: sp|P52408|E13B_PRUPE (Glucan endo-1,3-beta-glucosidase, basic isoform OS=Prunus persica OX=3760 GN=GNS1 PE=3 SV=1) HSP 1 Score: 101.7 bits (252), Expect = 4.4e-21 Identity = 50/82 (60.98%), Postives = 62/82 (75.61%), Query Frame = 0
BLAST of Cla97C01G009150 vs. Swiss-Prot
Match: sp|A7PQW3|E13B_VITVI (Glucan endo-1,3-beta-glucosidase OS=Vitis vinifera OX=29760 GN=VIT_06s0061g00120 PE=1 SV=2) HSP 1 Score: 101.3 bits (251), Expect = 5.7e-21 Identity = 49/83 (59.04%), Postives = 62/83 (74.70%), Query Frame = 0
BLAST of Cla97C01G009150 vs. Swiss-Prot
Match: sp|Q03773|E13A_SOYBN (Glucan endo-1,3-beta-glucosidase OS=Glycine max OX=3847 PE=1 SV=1) HSP 1 Score: 100.1 bits (248), Expect = 1.3e-20 Identity = 49/85 (57.65%), Postives = 62/85 (72.94%), Query Frame = 0
BLAST of Cla97C01G009150 vs. Swiss-Prot
Match: sp|F4J270|BG3_ARATH (Probable glucan endo-1,3-beta-glucosidase BG3 OS=Arabidopsis thaliana OX=3702 GN=BG3 PE=2 SV=1) HSP 1 Score: 97.8 bits (242), Expect = 6.3e-20 Identity = 50/82 (60.98%), Postives = 60/82 (73.17%), Query Frame = 0
BLAST of Cla97C01G009150 vs. TAIR10
Match: AT3G57270.1 (beta-1,3-glucanase 1) HSP 1 Score: 101.7 bits (252), Expect = 2.4e-22 Identity = 52/85 (61.18%), Postives = 60/85 (70.59%), Query Frame = 0
BLAST of Cla97C01G009150 vs. TAIR10
Match: AT3G57240.1 (beta-1,3-glucanase 3) HSP 1 Score: 97.8 bits (242), Expect = 3.5e-21 Identity = 50/82 (60.98%), Postives = 60/82 (73.17%), Query Frame = 0
BLAST of Cla97C01G009150 vs. TAIR10
Match: AT3G57260.1 (beta-1,3-glucanase 2) HSP 1 Score: 97.4 bits (241), Expect = 4.6e-21 Identity = 50/85 (58.82%), Postives = 60/85 (70.59%), Query Frame = 0
BLAST of Cla97C01G009150 vs. TAIR10
Match: AT4G16260.1 (Glycosyl hydrolase superfamily protein) HSP 1 Score: 92.8 bits (229), Expect = 1.1e-19 Identity = 46/89 (51.69%), Postives = 60/89 (67.42%), Query Frame = 0
BLAST of Cla97C01G009150 vs. TAIR10
Match: AT3G04010.1 (O-Glycosyl hydrolases family 17 protein) HSP 1 Score: 66.6 bits (161), Expect = 8.7e-12 Identity = 31/87 (35.63%), Postives = 47/87 (54.02%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of watermelon 97103 v2
Date Performed: 2019-05-12
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|