Cla021559 (gene) Watermelon (97103) v1
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGTCTACAACATGCAAAGGTAAATGAGTAATATTGCATCATCAAGTCATCTTCGGTTTTTGAACATTGTATTTATTTTAATTTTATCATTTTTTCACAATAATTTTAAATTTTAATTTAAAAAACACAAACTATGCCTATTTAGATTTTGGATTTTTAACACTATATTTATAAACATTATTTTTATATATAGATTTTTTTTTTCATGTTATTCAACCTACACGAGCTTAAATTTATGAAAAAATGAATTAATATCGTTTTGCATGTTTCACTTTTAGGAAAGAGTTCATGGCCGGAATTGGTTGGTAAGGCAGGAAAAGAAGCAGAGAAAATTATTGAGAAGGAGAATCCATTGGTTGACGCCATTATTGTTGATGAAGGATCAATGGTGATTCTAGACTTCAGGTGCGATAGGGTCTGGGTTTGGGTTGATTCCAAAACAGGCATAGTCACTAGGACTCCTTTCATTGGTTAA ATGTCTACAACATGCAAAGGAAAGAGTTCATGGCCGGAATTGGTTGGTAAGGCAGGAAAAGAAGCAGAGAAAATTATTGAGAAGGAGAATCCATTGGTTGACGCCATTATTGTTGATGAAGGATCAATGGTGATTCTAGACTTCAGGTGCGATAGGGTCTGGGTTTGGGTTGATTCCAAAACAGGCATAGTCACTAGGACTCCTTTCATTGGTTAA ATGTCTACAACATGCAAAGGAAAGAGTTCATGGCCGGAATTGGTTGGTAAGGCAGGAAAAGAAGCAGAGAAAATTATTGAGAAGGAGAATCCATTGGTTGACGCCATTATTGTTGATGAAGGATCAATGGTGATTCTAGACTTCAGGTGCGATAGGGTCTGGGTTTGGGTTGATTCCAAAACAGGCATAGTCACTAGGACTCCTTTCATTGGTTAA MSTTCKGKSSWPELVGKAGKEAEKIIEKENPLVDAIIVDEGSMVILDFRCDRVWVWVDSKTGIVTRTPFIG
BLAST of Cla021559 vs. Swiss-Prot
Match: BGIA_MOMCH (Glu S.griseus protease inhibitor OS=Momordica charantia PE=1 SV=1) HSP 1 Score: 80.9 bits (198), Expect = 6.3e-15 Identity = 40/67 (59.70%), Postives = 46/67 (68.66%), Query Frame = 1
BLAST of Cla021559 vs. Swiss-Prot
Match: ITH5_CUCMA (Inhibitor of trypsin and hageman factor OS=Cucurbita maxima PE=1 SV=1) HSP 1 Score: 77.8 bits (190), Expect = 5.3e-14 Identity = 37/69 (53.62%), Postives = 49/69 (71.01%), Query Frame = 1
BLAST of Cla021559 vs. Swiss-Prot
Match: ATSI_AMACA (Trypsin/subtilisin inhibitor OS=Amaranthus caudatus PE=1 SV=1) HSP 1 Score: 77.4 bits (189), Expect = 7.0e-14 Identity = 39/64 (60.94%), Postives = 43/64 (67.19%), Query Frame = 1
BLAST of Cla021559 vs. Swiss-Prot
Match: ICI_LINUS (Proteinase inhibitor OS=Linum usitatissimum PE=1 SV=1) HSP 1 Score: 75.9 bits (185), Expect = 2.0e-13 Identity = 37/69 (53.62%), Postives = 45/69 (65.22%), Query Frame = 1
BLAST of Cla021559 vs. Swiss-Prot
Match: ITI_FAGTA (Trypsin inhibitor OS=Fagopyrum tataricum PE=1 SV=1) HSP 1 Score: 61.2 bits (147), Expect = 5.2e-09 Identity = 33/72 (45.83%), Postives = 41/72 (56.94%), Query Frame = 1
BLAST of Cla021559 vs. TrEMBL
Match: A0A0A0L795_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_3G142960 PE=4 SV=1) HSP 1 Score: 138.3 bits (347), Expect = 3.7e-30 Identity = 65/71 (91.55%), Postives = 67/71 (94.37%), Query Frame = 1
BLAST of Cla021559 vs. TrEMBL
Match: U5G1C3_POPTR (Uncharacterized protein OS=Populus trichocarpa GN=POPTR_0010s08600g PE=4 SV=1) HSP 1 Score: 105.9 bits (263), Expect = 2.0e-20 Identity = 52/69 (75.36%), Postives = 57/69 (82.61%), Query Frame = 1
BLAST of Cla021559 vs. TrEMBL
Match: B1ACD2_SOYBN (Putative protease inhibitor OS=Glycine max GN=GLYMA_10G184700 PE=2 SV=1) HSP 1 Score: 105.9 bits (263), Expect = 2.0e-20 Identity = 52/71 (73.24%), Postives = 55/71 (77.46%), Query Frame = 1
BLAST of Cla021559 vs. TrEMBL
Match: A0A0B2P035_GLYSO (Inhibitor of trypsin and hageman factor OS=Glycine soja GN=glysoja_000750 PE=4 SV=1) HSP 1 Score: 105.9 bits (263), Expect = 2.0e-20 Identity = 52/71 (73.24%), Postives = 55/71 (77.46%), Query Frame = 1
BLAST of Cla021559 vs. TrEMBL
Match: A0A0A0L4J0_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_3G142970 PE=4 SV=1) HSP 1 Score: 104.8 bits (260), Expect = 4.5e-20 Identity = 50/71 (70.42%), Postives = 55/71 (77.46%), Query Frame = 1
BLAST of Cla021559 vs. NCBI nr
Match: gi|449432606|ref|XP_004134090.1| (PREDICTED: glu S.griseus protease inhibitor-like [Cucumis sativus]) HSP 1 Score: 138.3 bits (347), Expect = 5.3e-30 Identity = 65/71 (91.55%), Postives = 67/71 (94.37%), Query Frame = 1
BLAST of Cla021559 vs. NCBI nr
Match: gi|659076233|ref|XP_008438570.1| (PREDICTED: glu S.griseus protease inhibitor-like [Cucumis melo]) HSP 1 Score: 137.9 bits (346), Expect = 6.9e-30 Identity = 65/71 (91.55%), Postives = 67/71 (94.37%), Query Frame = 1
BLAST of Cla021559 vs. NCBI nr
Match: gi|351727373|ref|NP_001238694.1| (protease inhibitor-like [Glycine max]) HSP 1 Score: 105.9 bits (263), Expect = 2.9e-20 Identity = 52/71 (73.24%), Postives = 55/71 (77.46%), Query Frame = 1
BLAST of Cla021559 vs. NCBI nr
Match: gi|566189800|ref|XP_006378352.1| (hypothetical protein POPTR_0010s08600g [Populus trichocarpa]) HSP 1 Score: 105.9 bits (263), Expect = 2.9e-20 Identity = 52/69 (75.36%), Postives = 57/69 (82.61%), Query Frame = 1
BLAST of Cla021559 vs. NCBI nr
Match: gi|357441047|ref|XP_003590801.1| (inhibitor of trypsin and hageman factor-like protein [Medicago truncatula]) HSP 1 Score: 104.8 bits (260), Expect = 6.5e-20 Identity = 52/67 (77.61%), Postives = 55/67 (82.09%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
This gene is associated with the following unigenes:
Analysis Name: InterPro Annotations of watermelon (97103)
Date Performed: 2016-09-28
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene: |