Cla016003 (gene) Watermelon (97103) v1
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGTAAACATCTCTCCTAACAGCTTGAAGGACTTCAAGAACTTCGCCGATGCACTCGAGGCAGTTAGAAACAAAGGAGTGGTAGTTTCAGTTGCATCTCCCGAAGACGTCGAAACTGCACACAGCGAACGCCCAGGTTTTTTCCAAGTGAAGAAAGCCCTCTAA ATGGTAAACATCTCTCCTAACAGCTTGAAGGACTTCAAGAACTTCGCCGATGCACTCGAGGCAGTTAGAAACAAAGGAGTGGTAGTTTCAGTTGCATCTCCCGAAGACGTCGAAACTGCACACAGCGAACGCCCAGGTTTTTTCCAAGTGAAGAAAGCCCTCTAA ATGGTAAACATCTCTCCTAACAGCTTGAAGGACTTCAAGAACTTCGCCGATGCACTCGAGGCAGTTAGAAACAAAGGAGTGGTAGTTTCAGTTGCATCTCCCGAAGACGTCGAAACTGCACACAGCGAACGCCCAGGTTTTTTCCAAGTGAAGAAAGCCCTCTAA MVNISPNSLKDFKNFADALEAVRNKGVVVSVASPEDVETAHSERPGFFQVKKAL
BLAST of Cla016003 vs. Swiss-Prot
Match: PREP1_ARATH (Presequence protease 1, chloroplastic/mitochondrial OS=Arabidopsis thaliana GN=PREP1 PE=1 SV=2) HSP 1 Score: 65.5 bits (158), Expect = 2.1e-10 Identity = 31/51 (60.78%), Postives = 39/51 (76.47%), Query Frame = 1
BLAST of Cla016003 vs. Swiss-Prot
Match: PREP2_ARATH (Presequence protease 2, chloroplastic/mitochondrial OS=Arabidopsis thaliana GN=PREP2 PE=1 SV=1) HSP 1 Score: 61.6 bits (148), Expect = 3.0e-09 Identity = 29/50 (58.00%), Postives = 37/50 (74.00%), Query Frame = 1
BLAST of Cla016003 vs. TrEMBL
Match: A0A0A0K809_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_7G073760 PE=3 SV=1) HSP 1 Score: 93.2 bits (230), Expect = 1.0e-16 Identity = 47/51 (92.16%), Postives = 47/51 (92.16%), Query Frame = 1
BLAST of Cla016003 vs. TrEMBL
Match: V7CIR1_PHAVU (Uncharacterized protein OS=Phaseolus vulgaris GN=PHAVU_002G054400g PE=3 SV=1) HSP 1 Score: 79.0 bits (193), Expect = 2.0e-12 Identity = 38/51 (74.51%), Postives = 44/51 (86.27%), Query Frame = 1
BLAST of Cla016003 vs. TrEMBL
Match: A0A0S3T7K4_PHAAN (Uncharacterized protein OS=Vigna angularis var. angularis GN=Vigan.10G250100 PE=3 SV=1) HSP 1 Score: 76.3 bits (186), Expect = 1.3e-11 Identity = 37/51 (72.55%), Postives = 43/51 (84.31%), Query Frame = 1
BLAST of Cla016003 vs. TrEMBL
Match: A0A0L9T7U8_PHAAN (Uncharacterized protein OS=Phaseolus angularis GN=LR48_Vigan303s007000 PE=3 SV=1) HSP 1 Score: 76.3 bits (186), Expect = 1.3e-11 Identity = 37/51 (72.55%), Postives = 43/51 (84.31%), Query Frame = 1
BLAST of Cla016003 vs. TrEMBL
Match: A0A0R4J2L6_SOYBN (Uncharacterized protein OS=Glycine max GN=GLYMA_01G244900 PE=3 SV=1) HSP 1 Score: 75.1 bits (183), Expect = 2.9e-11 Identity = 37/51 (72.55%), Postives = 44/51 (86.27%), Query Frame = 1
BLAST of Cla016003 vs. NCBI nr
Match: gi|659109889|ref|XP_008454934.1| (PREDICTED: presequence protease 1, chloroplastic/mitochondrial-like [Cucumis melo]) HSP 1 Score: 94.7 bits (234), Expect = 5.1e-17 Identity = 48/51 (94.12%), Postives = 48/51 (94.12%), Query Frame = 1
BLAST of Cla016003 vs. NCBI nr
Match: gi|449438420|ref|XP_004136986.1| (PREDICTED: presequence protease 1, chloroplastic/mitochondrial-like [Cucumis sativus]) HSP 1 Score: 93.2 bits (230), Expect = 1.5e-16 Identity = 47/51 (92.16%), Postives = 47/51 (92.16%), Query Frame = 1
BLAST of Cla016003 vs. NCBI nr
Match: gi|593788400|ref|XP_007157239.1| (hypothetical protein PHAVU_002G054400g [Phaseolus vulgaris]) HSP 1 Score: 79.0 bits (193), Expect = 2.9e-12 Identity = 38/51 (74.51%), Postives = 44/51 (86.27%), Query Frame = 1
BLAST of Cla016003 vs. NCBI nr
Match: gi|672170558|ref|XP_008805339.1| (PREDICTED: LOW QUALITY PROTEIN: presequence protease 1, chloroplastic/mitochondrial-like, partial [Phoenix dactylifera]) HSP 1 Score: 76.6 bits (187), Expect = 1.4e-11 Identity = 38/51 (74.51%), Postives = 42/51 (82.35%), Query Frame = 1
BLAST of Cla016003 vs. NCBI nr
Match: gi|951052305|ref|XP_014520661.1| (PREDICTED: presequence protease 1, chloroplastic/mitochondrial-like [Vigna radiata var. radiata]) HSP 1 Score: 76.3 bits (186), Expect = 1.9e-11 Identity = 37/51 (72.55%), Postives = 43/51 (84.31%), Query Frame = 1
The following BLAST results are available for this feature:
GO Assignments
This gene is annotated with the following GO terms.
This gene is associated with the following unigenes:
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene: |