Cla015985 (gene) Watermelon (97103) v1

NameCla015985
Typegene
OrganismCitrullus. lanatus (Watermelon (97103) v1)
DescriptionUnknown Protein (AHRD V1)
LocationChr2 : 5812967 .. 5813158 (+)
The following sequences are available for this feature:

Gene sequence (with intron)

Legend: CDS
Hold the cursor over a type above to highlight its positions in the sequence below.
ATGAGAGTTAGCAGGGAGACTTGCAAGGAATATGTTGACGAATTGGAGAAACTTGGCTACAAATTGATGGAACTGATCGGCGTTAGCTTGGGATTACCGGCGGGAAGGTTTCGAGTTGGCTCTTGGCATCGGCCACCACAAGGACTCTGGCGTCTTGATAGTGCTCGCCCAAGACGACGTCGGAGGGCTTGA

mRNA sequence

ATGAGAGTTAGCAGGGAGACTTGCAAGGAATATGTTGACGAATTGGAGAAACTTGGCTACAAATTGATGGAACTGATCGGCGTTAGCTTGGGATTACCGGCGGGAAGGTTTCGAGTTGGCTCTTGGCATCGGCCACCACAAGGACTCTGGCGTCTTGATAGTGCTCGCCCAAGACGACGTCGGAGGGCTTGA

Coding sequence (CDS)

ATGAGAGTTAGCAGGGAGACTTGCAAGGAATATGTTGACGAATTGGAGAAACTTGGCTACAAATTGATGGAACTGATCGGCGTTAGCTTGGGATTACCGGCGGGAAGGTTTCGAGTTGGCTCTTGGCATCGGCCACCACAAGGACTCTGGCGTCTTGATAGTGCTCGCCCAAGACGACGTCGGAGGGCTTGA

Protein sequence

MRVSRETCKEYVDELEKLGYKLMELIGVSLGLPAGRFRVGSWHRPPQGLWRLDSARPRRRRRA
The following terms have been associated with this gene:
Vocabulary: INTERPRO
TermDefinition
IPR027443IPNS-like
GO Assignments
This gene is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0055114 oxidation-reduction process
cellular_component GO:0005575 cellular_component
molecular_function GO:0046872 metal ion binding
molecular_function GO:0016706 oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, 2-oxoglutarate as one donor, and incorporation of one atom each of oxygen into both donors

The following mRNA feature(s) are a part of this gene:

Feature NameUnique NameType
Cla015985Cla015985.1mRNA


Analysis Name: InterPro Annotations of watermelon (97103)
Date Performed: 2016-09-28
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR027443Isopenicillin N synthase-likeGENE3DG3DSA:2.60.120.330coord: 5..38
score: 4.

The following gene(s) are orthologous to this gene:
GeneOrthologueOrganismBlock
Cla015985ClCG02G005630Watermelon (Charleston Gray)wcgwmB198
The following gene(s) are paralogous to this gene:

None

The following block(s) are covering this gene:
GeneOrganismBlock
Cla015985Cucumber (Gy14) v1cgywmB155
Cla015985Cucumber (Gy14) v1cgywmB427
Cla015985Cucumber (Gy14) v1cgywmB435
Cla015985Cucurbita maxima (Rimu)cmawmB127
Cla015985Cucurbita maxima (Rimu)cmawmB503
Cla015985Cucurbita maxima (Rimu)cmawmB586
Cla015985Cucurbita maxima (Rimu)cmawmB842
Cla015985Cucurbita moschata (Rifu)cmowmB109
Cla015985Cucurbita moschata (Rifu)cmowmB496
Cla015985Cucurbita moschata (Rifu)cmowmB833
Cla015985Melon (DHL92) v3.5.1mewmB118
Cla015985Melon (DHL92) v3.5.1mewmB240
Cla015985Watermelon (Charleston Gray)wcgwmB162
Cla015985Watermelon (Charleston Gray)wcgwmB421
Cla015985Cucumber (Chinese Long) v2cuwmB149
Cla015985Cucumber (Chinese Long) v2cuwmB605
Cla015985Cucurbita pepo (Zucchini)cpewmB268
Cla015985Cucurbita pepo (Zucchini)cpewmB500
Cla015985Cucurbita pepo (Zucchini)cpewmB665
Cla015985Cucurbita pepo (Zucchini)cpewmB748
Cla015985Bottle gourd (USVL1VR-Ls)lsiwmB079
Cla015985Bottle gourd (USVL1VR-Ls)lsiwmB106
Cla015985Bottle gourd (USVL1VR-Ls)lsiwmB164
Cla015985Bottle gourd (USVL1VR-Ls)lsiwmB492
Cla015985Cucumber (Gy14) v2cgybwmB141
Cla015985Cucumber (Gy14) v2cgybwmB142
Cla015985Cucumber (Gy14) v2cgybwmB567
Cla015985Melon (DHL92) v3.6.1medwmB232
Cla015985Melon (DHL92) v3.6.1medwmB323
Cla015985Melon (DHL92) v3.6.1medwmB579
Cla015985Silver-seed gourdcarwmB0198
Cla015985Silver-seed gourdcarwmB0812
Cla015985Silver-seed gourdcarwmB0895
Cla015985Cucumber (Chinese Long) v3cucwmB160
Cla015985Cucumber (Chinese Long) v3cucwmB164
Cla015985Cucumber (Chinese Long) v3cucwmB635
Cla015985Watermelon (97103) v2wmwmbB306
Cla015985Watermelon (97103) v2wmwmbB317
Cla015985Watermelon (97103) v2wmwmbB348
Cla015985Watermelon (97103) v2wmwmbB353
Cla015985Wax gourdwgowmB280
Cla015985Watermelon (97103) v1wmwmB072
Cla015985Watermelon (97103) v1wmwmB143