Cla015865 (gene) Watermelon (97103) v1
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.AATGTACCAAAGGGATACTTTACAGTTTATGTTGGTGAGGTACAAAAGAAGCGTTTTGTCATCCCACTATCATACTTGAACCAGCCGTCTTTTCAAGATTTGTTGAGTCAAGCAGAAGAAGAATTTGGATATAATCATCCAATGGGTGCCATCACAATTCCTTGCAGTGAAAACTATTTCCTTGATCTCACTCGGAGTTGGAATGATTCATGA AATGTACCAAAGGGATACTTTACAGTTTATGTTGGTGAGGTACAAAAGAAGCGTTTTGTCATCCCACTATCATACTTGAACCAGCCGTCTTTTCAAGATTTGTTGAGTCAAGCAGAAGAAGAATTTGGATATAATCATCCAATGGGTGCCATCACAATTCCTTGCAGTGAAAACTATTTCCTTGATCTCACTCGGAGTTGGAATGATTCATGA AATGTACCAAAGGGATACTTTACAGTTTATGTTGGTGAGGTACAAAAGAAGCGTTTTGTCATCCCACTATCATACTTGAACCAGCCGTCTTTTCAAGATTTGTTGAGTCAAGCAGAAGAAGAATTTGGATATAATCATCCAATGGGTGCCATCACAATTCCTTGCAGTGAAAACTATTTCCTTGATCTCACTCGGAGTTGGAATGATTCATGA NVPKGYFTVYVGEVQKKRFVIPLSYLNQPSFQDLLSQAEEEFGYNHPMGAITIPCSENYFLDLTRSWNDS
BLAST of Cla015865 vs. Swiss-Prot
Match: AX15A_SOYBN (Auxin-induced protein 15A OS=Glycine max PE=2 SV=1) HSP 1 Score: 102.1 bits (253), Expect = 2.6e-21 Identity = 49/68 (72.06%), Postives = 54/68 (79.41%), Query Frame = 1
BLAST of Cla015865 vs. Swiss-Prot
Match: AX10A_SOYBN (Auxin-induced protein X10A OS=Glycine max PE=2 SV=1) HSP 1 Score: 102.1 bits (253), Expect = 2.6e-21 Identity = 47/68 (69.12%), Postives = 55/68 (80.88%), Query Frame = 1
BLAST of Cla015865 vs. Swiss-Prot
Match: AXX15_SOYBN (Auxin-induced protein X15 OS=Glycine max PE=2 SV=1) HSP 1 Score: 99.8 bits (247), Expect = 1.3e-20 Identity = 46/64 (71.88%), Postives = 52/64 (81.25%), Query Frame = 1
BLAST of Cla015865 vs. Swiss-Prot
Match: SAU23_ARATH (Auxin-responsive protein SAUR23 OS=Arabidopsis thaliana GN=SAUR23 PE=2 SV=1) HSP 1 Score: 99.0 bits (245), Expect = 2.2e-20 Identity = 42/62 (67.74%), Postives = 53/62 (85.48%), Query Frame = 1
BLAST of Cla015865 vs. Swiss-Prot
Match: A10A5_SOYBN (Auxin-induced protein 10A5 OS=Glycine max PE=2 SV=1) HSP 1 Score: 98.6 bits (244), Expect = 2.9e-20 Identity = 45/69 (65.22%), Postives = 55/69 (79.71%), Query Frame = 1
BLAST of Cla015865 vs. TrEMBL
Match: A0A0A0K4J0_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_7G008980 PE=4 SV=1) HSP 1 Score: 132.9 bits (333), Expect = 1.5e-28 Identity = 62/70 (88.57%), Postives = 65/70 (92.86%), Query Frame = 1
BLAST of Cla015865 vs. TrEMBL
Match: A0A0A0K0H6_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_7G008960 PE=4 SV=1) HSP 1 Score: 132.5 bits (332), Expect = 2.0e-28 Identity = 62/70 (88.57%), Postives = 65/70 (92.86%), Query Frame = 1
BLAST of Cla015865 vs. TrEMBL
Match: A0A0A0K5T8_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_7G009020 PE=4 SV=1) HSP 1 Score: 127.1 bits (318), Expect = 8.4e-27 Identity = 60/70 (85.71%), Postives = 64/70 (91.43%), Query Frame = 1
BLAST of Cla015865 vs. TrEMBL
Match: A0A0A0K160_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_7G008990 PE=4 SV=1) HSP 1 Score: 126.3 bits (316), Expect = 1.4e-26 Identity = 59/70 (84.29%), Postives = 64/70 (91.43%), Query Frame = 1
BLAST of Cla015865 vs. TrEMBL
Match: A0A0A0K2F5_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_7G009000 PE=4 SV=1) HSP 1 Score: 125.9 bits (315), Expect = 1.9e-26 Identity = 58/65 (89.23%), Postives = 61/65 (93.85%), Query Frame = 1
BLAST of Cla015865 vs. NCBI nr
Match: gi|778722823|ref|XP_011658575.1| (PREDICTED: auxin-induced protein 15A-like [Cucumis sativus]) HSP 1 Score: 132.9 bits (333), Expect = 2.2e-28 Identity = 62/70 (88.57%), Postives = 65/70 (92.86%), Query Frame = 1
BLAST of Cla015865 vs. NCBI nr
Match: gi|778722827|ref|XP_011658577.1| (PREDICTED: auxin-induced protein 15A-like [Cucumis sativus]) HSP 1 Score: 132.9 bits (333), Expect = 2.2e-28 Identity = 62/70 (88.57%), Postives = 65/70 (92.86%), Query Frame = 1
BLAST of Cla015865 vs. NCBI nr
Match: gi|778722816|ref|XP_011658573.1| (PREDICTED: auxin-induced protein 15A-like [Cucumis sativus]) HSP 1 Score: 132.5 bits (332), Expect = 2.9e-28 Identity = 62/70 (88.57%), Postives = 65/70 (92.86%), Query Frame = 1
BLAST of Cla015865 vs. NCBI nr
Match: gi|659094352|ref|XP_008448014.1| (PREDICTED: auxin-induced protein 15A-like [Cucumis melo]) HSP 1 Score: 128.6 bits (322), Expect = 4.1e-27 Identity = 59/70 (84.29%), Postives = 64/70 (91.43%), Query Frame = 1
BLAST of Cla015865 vs. NCBI nr
Match: gi|778722830|ref|XP_004144905.2| (PREDICTED: auxin-induced protein X10A-like [Cucumis sativus]) HSP 1 Score: 127.1 bits (318), Expect = 1.2e-26 Identity = 60/70 (85.71%), Postives = 64/70 (91.43%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of watermelon (97103)
Date Performed: 2016-09-28
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene: |