Cla012907 (gene) Watermelon (97103) v1
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGACAAGGAAGAAAATTCAGATCAAGAAGATTGACAACATAGCTGCAAGACAAGTTGCATTTTCAAAGAGAAGAAAAGGGCTTTTCAAGAAGGCTAAAGAGCTTGCAATTCTTTGTGATGCTGAGATTGGCCTTCTTGTTTTTTCTGCTTCTGGGAAGCTCTTTGACTATGCAAGTTCAAGGTTTTCTCTCTCTTAA ATGACAAGGAAGAAAATTCAGATCAAGAAGATTGACAACATAGCTGCAAGACAAGTTGCATTTTCAAAGAGAAGAAAAGGGCTTTTCAAGAAGGCTAAAGAGCTTGCAATTCTTTGTGATGCTGAGATTGGCCTTCTTGTTTTTTCTGCTTCTGGGAAGCTCTTTGACTATGCAAGTTCAAGGTTTTCTCTCTCTTAA ATGACAAGGAAGAAAATTCAGATCAAGAAGATTGACAACATAGCTGCAAGACAAGTTGCATTTTCAAAGAGAAGAAAAGGGCTTTTCAAGAAGGCTAAAGAGCTTGCAATTCTTTGTGATGCTGAGATTGGCCTTCTTGTTTTTTCTGCTTCTGGGAAGCTCTTTGACTATGCAAGTTCAAGGTTTTCTCTCTCTTAA MTRKKIQIKKIDNIAARQVAFSKRRKGLFKKAKELAILCDAEIGLLVFSASGKLFDYASSRFSLS
BLAST of Cla012907 vs. Swiss-Prot
Match: JOIN_SOLLC (MADS-box protein JOINTLESS OS=Solanum lycopersicum GN=J PE=1 SV=1) HSP 1 Score: 94.7 bits (234), Expect = 3.9e-19 Identity = 43/60 (71.67%), Postives = 53/60 (88.33%), Query Frame = 1
BLAST of Cla012907 vs. Swiss-Prot
Match: AGL24_ARATH (MADS-box protein AGL24 OS=Arabidopsis thaliana GN=AGL24 PE=1 SV=1) HSP 1 Score: 94.0 bits (232), Expect = 6.6e-19 Identity = 42/61 (68.85%), Postives = 54/61 (88.52%), Query Frame = 1
BLAST of Cla012907 vs. Swiss-Prot
Match: MAD47_ORYSJ (MADS-box transcription factor 47 OS=Oryza sativa subsp. japonica GN=MADS47 PE=1 SV=2) HSP 1 Score: 91.3 bits (225), Expect = 4.3e-18 Identity = 42/58 (72.41%), Postives = 53/58 (91.38%), Query Frame = 1
BLAST of Cla012907 vs. Swiss-Prot
Match: SVP_ARATH (MADS-box protein SVP OS=Arabidopsis thaliana GN=SVP PE=1 SV=1) HSP 1 Score: 90.5 bits (223), Expect = 7.3e-18 Identity = 40/60 (66.67%), Postives = 52/60 (86.67%), Query Frame = 1
BLAST of Cla012907 vs. Swiss-Prot
Match: MAD23_ORYSJ (MADS-box transcription factor 23 OS=Oryza sativa subsp. japonica GN=MADS23 PE=2 SV=1) HSP 1 Score: 89.4 bits (220), Expect = 1.6e-17 Identity = 42/60 (70.00%), Postives = 51/60 (85.00%), Query Frame = 1
BLAST of Cla012907 vs. TrEMBL
Match: B9S9I4_RICCO (Mads box protein, putative OS=Ricinus communis GN=RCOM_0885720 PE=4 SV=1) HSP 1 Score: 101.7 bits (252), Expect = 3.5e-19 Identity = 51/61 (83.61%), Postives = 56/61 (91.80%), Query Frame = 1
BLAST of Cla012907 vs. TrEMBL
Match: B0FLP5_EUPES (Dormancy associated MADS-box protein OS=Euphorbia esula GN=DAM1 PE=4 SV=1) HSP 1 Score: 101.3 bits (251), Expect = 4.6e-19 Identity = 50/61 (81.97%), Postives = 56/61 (91.80%), Query Frame = 1
BLAST of Cla012907 vs. TrEMBL
Match: A0A0R0KBY2_SOYBN (Uncharacterized protein OS=Glycine max GN=GLYMA_04G093900 PE=4 SV=1) HSP 1 Score: 101.3 bits (251), Expect = 4.6e-19 Identity = 46/62 (74.19%), Postives = 59/62 (95.16%), Query Frame = 1
BLAST of Cla012907 vs. TrEMBL
Match: K7KJ40_SOYBN (Uncharacterized protein OS=Glycine max PE=4 SV=1) HSP 1 Score: 101.3 bits (251), Expect = 4.6e-19 Identity = 46/62 (74.19%), Postives = 59/62 (95.16%), Query Frame = 1
BLAST of Cla012907 vs. TrEMBL
Match: A0A0D2SLU8_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_005G225500 PE=4 SV=1) HSP 1 Score: 100.5 bits (249), Expect = 7.8e-19 Identity = 48/60 (80.00%), Postives = 56/60 (93.33%), Query Frame = 1
BLAST of Cla012907 vs. NCBI nr
Match: gi|778724526|ref|XP_004136891.2| (PREDICTED: MADS-box protein SVP-like [Cucumis sativus]) HSP 1 Score: 116.3 bits (290), Expect = 2.0e-23 Identity = 60/60 (100.00%), Postives = 60/60 (100.00%), Query Frame = 1
BLAST of Cla012907 vs. NCBI nr
Match: gi|659110273|ref|XP_008455140.1| (PREDICTED: MADS-box protein SVP-like isoform X1 [Cucumis melo]) HSP 1 Score: 116.3 bits (290), Expect = 2.0e-23 Identity = 60/60 (100.00%), Postives = 60/60 (100.00%), Query Frame = 1
BLAST of Cla012907 vs. NCBI nr
Match: gi|659110275|ref|XP_008455141.1| (PREDICTED: MADS-box protein JOINTLESS-like isoform X2 [Cucumis melo]) HSP 1 Score: 116.3 bits (290), Expect = 2.0e-23 Identity = 60/60 (100.00%), Postives = 60/60 (100.00%), Query Frame = 1
BLAST of Cla012907 vs. NCBI nr
Match: gi|1009151879|ref|XP_015893790.1| (PREDICTED: MADS-box protein JOINTLESS-like [Ziziphus jujuba]) HSP 1 Score: 104.4 bits (259), Expect = 7.8e-20 Identity = 51/60 (85.00%), Postives = 57/60 (95.00%), Query Frame = 1
BLAST of Cla012907 vs. NCBI nr
Match: gi|223538129|gb|EEF39740.1| (mads box protein, putative [Ricinus communis]) HSP 1 Score: 101.7 bits (252), Expect = 5.0e-19 Identity = 51/61 (83.61%), Postives = 56/61 (91.80%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of watermelon (97103)
Date Performed: 2016-09-28
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|