Cla010775 (gene) Watermelon (97103) v1
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGCTGTTTTTCTCAGCGGAGCTCGTGTGGCGGAGGCGGTGACTTGCAGCCCTTCGGAGCTGAGCTCATGTGCGGGGGCAATCTGGTCGTCATCGTCGAATCCATCGAGCTTTTGCTGCAGTAAGTTGAGAGAGCAACAACCATGCCTTTGTGGGTACATAAGGAACCCATCCTTAAGGCCTTATGTGCAATCTCCTGGCGCTAAATCTGTGGCTTCCAAGTGTGGTGTTCCCTTCCCCAGCTGCTAG ATGGCTGTTTTTCTCAGCGGAGCTCGTGTGGCGGAGGCGGTGACTTGCAGCCCTTCGGAGCTGAGCTCATGTGCGGGGGCAATCTGGTCGTCATCGTCGAATCCATCGAGCTTTTGCTGCAGTAAGTTGAGAGAGCAACAACCATGCCTTTGTGGGTACATAAGGAACCCATCCTTAAGGCCTTATGTGCAATCTCCTGGCGCTAAATCTGTGGCTTCCAAGTGTGGTGTTCCCTTCCCCAGCTGCTAG ATGGCTGTTTTTCTCAGCGGAGCTCGTGTGGCGGAGGCGGTGACTTGCAGCCCTTCGGAGCTGAGCTCATGTGCGGGGGCAATCTGGTCGTCATCGTCGAATCCATCGAGCTTTTGCTGCAGTAAGTTGAGAGAGCAACAACCATGCCTTTGTGGGTACATAAGGAACCCATCCTTAAGGCCTTATGTGCAATCTCCTGGCGCTAAATCTGTGGCTTCCAAGTGTGGTGTTCCCTTCCCCAGCTGCTAG MAVFLSGARVAEAVTCSPSELSSCAGAIWSSSSNPSSFCCSKLREQQPCLCGYIRNPSLRPYVQSPGAKSVASKCGVPFPSC
BLAST of Cla010775 vs. Swiss-Prot
Match: NLTP_VIGUN (Probable non-specific lipid-transfer protein AKCS9 OS=Vigna unguiculata PE=2 SV=1) HSP 1 Score: 107.1 bits (266), Expect = 9.5e-23 Identity = 49/73 (67.12%), Postives = 56/73 (76.71%), Query Frame = 1
BLAST of Cla010775 vs. Swiss-Prot
Match: NLTP2_PRUAR (Non-specific lipid-transfer protein 2 OS=Prunus armeniaca PE=1 SV=1) HSP 1 Score: 98.2 bits (243), Expect = 4.4e-20 Identity = 43/69 (62.32%), Postives = 51/69 (73.91%), Query Frame = 1
BLAST of Cla010775 vs. Swiss-Prot
Match: NLTP2_APIGA (Non-specific lipid-transfer protein 2 OS=Apium graveolens var. rapaceum PE=1 SV=1) HSP 1 Score: 81.6 bits (200), Expect = 4.3e-15 Identity = 35/63 (55.56%), Postives = 47/63 (74.60%), Query Frame = 1
BLAST of Cla010775 vs. Swiss-Prot
Match: NLTP2_HORVU (Probable non-specific lipid-transfer protein OS=Hordeum vulgare GN=LTP2 PE=2 SV=1) HSP 1 Score: 73.6 bits (179), Expect = 1.2e-12 Identity = 32/77 (41.56%), Postives = 43/77 (55.84%), Query Frame = 1
BLAST of Cla010775 vs. Swiss-Prot
Match: NLTPX_ORYSI (Non-specific lipid-transfer protein 2 OS=Oryza sativa subsp. indica GN=LTP-2 PE=3 SV=2) HSP 1 Score: 68.2 bits (165), Expect = 4.9e-11 Identity = 28/68 (41.18%), Postives = 41/68 (60.29%), Query Frame = 1
BLAST of Cla010775 vs. TrEMBL
Match: A0A0B2QIV0_GLYSO (Putative non-specific lipid-transfer protein AKCS9 OS=Glycine soja GN=glysoja_037194 PE=4 SV=1) HSP 1 Score: 117.9 bits (294), Expect = 6.0e-24 Identity = 53/73 (72.60%), Postives = 63/73 (86.30%), Query Frame = 1
BLAST of Cla010775 vs. TrEMBL
Match: I1N5L5_SOYBN (Uncharacterized protein OS=Glycine max GN=GLYMA_19G002300 PE=4 SV=1) HSP 1 Score: 117.9 bits (294), Expect = 6.0e-24 Identity = 53/73 (72.60%), Postives = 63/73 (86.30%), Query Frame = 1
BLAST of Cla010775 vs. TrEMBL
Match: A0A059BT60_EUCGR (Uncharacterized protein OS=Eucalyptus grandis GN=EUGRSUZ_F02788 PE=4 SV=1) HSP 1 Score: 116.7 bits (291), Expect = 1.3e-23 Identity = 55/75 (73.33%), Postives = 63/75 (84.00%), Query Frame = 1
BLAST of Cla010775 vs. TrEMBL
Match: I3SYA6_LOTJA (Uncharacterized protein OS=Lotus japonicus PE=2 SV=1) HSP 1 Score: 116.3 bits (290), Expect = 1.7e-23 Identity = 53/75 (70.67%), Postives = 62/75 (82.67%), Query Frame = 1
BLAST of Cla010775 vs. TrEMBL
Match: A0A151RN87_CAJCA (Non-specific lipid-transfer protein 2 OS=Cajanus cajan GN=KK1_034539 PE=4 SV=1) HSP 1 Score: 114.0 bits (284), Expect = 8.6e-23 Identity = 52/71 (73.24%), Postives = 60/71 (84.51%), Query Frame = 1
BLAST of Cla010775 vs. NCBI nr
Match: gi|659086721|ref|XP_008444081.1| (PREDICTED: non-specific lipid-transfer protein 2-like [Cucumis melo]) HSP 1 Score: 120.9 bits (302), Expect = 1.0e-24 Identity = 55/78 (70.51%), Postives = 67/78 (85.90%), Query Frame = 1
BLAST of Cla010775 vs. NCBI nr
Match: gi|734371828|gb|KHN19692.1| (Putative non-specific lipid-transfer protein AKCS9 [Glycine soja]) HSP 1 Score: 117.9 bits (294), Expect = 8.6e-24 Identity = 53/73 (72.60%), Postives = 63/73 (86.30%), Query Frame = 1
BLAST of Cla010775 vs. NCBI nr
Match: gi|702374176|ref|XP_010062205.1| (PREDICTED: non-specific lipid-transfer protein 2-like [Eucalyptus grandis]) HSP 1 Score: 116.7 bits (291), Expect = 1.9e-23 Identity = 55/75 (73.33%), Postives = 63/75 (84.00%), Query Frame = 1
BLAST of Cla010775 vs. NCBI nr
Match: gi|388514373|gb|AFK45248.1| (unknown [Lotus japonicus]) HSP 1 Score: 116.3 bits (290), Expect = 2.5e-23 Identity = 53/75 (70.67%), Postives = 62/75 (82.67%), Query Frame = 1
BLAST of Cla010775 vs. NCBI nr
Match: gi|697144902|ref|XP_009626576.1| (PREDICTED: non-specific lipid-transfer protein 2-like [Nicotiana tomentosiformis]) HSP 1 Score: 114.8 bits (286), Expect = 7.3e-23 Identity = 54/82 (65.85%), Postives = 62/82 (75.61%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
This gene is associated with the following unigenes:
Analysis Name: InterPro Annotations of watermelon (97103)
Date Performed: 2016-09-28
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|