Cla006935 (gene) Watermelon (97103) v1
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGTCGTCGAGACTTTCGCGTGGGACTTTTAATGGTGGCTTACTTTCCACCGAAGCTGGAACTATAGCTCGAGTGATTGCCGATGGCACGATAACATTGTCAGGGTACTTGGGTGAAAGTAAGCTCTTGAATGTTACCTTACTTCCTTCACTTTTTATTTGTGTATATGCCATTATAGCAACATGTTTTACCTACAACTCTCTTTACTAA ATGTCGTCGAGACTTTCGCGTGGGACTTTTAATGGTGGCTTACTTTCCACCGAAGCTGGAACTATAGCTCGAGTGATTGCCGATGGCACGATAACATTGTCAGGGTACTTGGGTGAAAGTAAGCTCTTGAATGTTACCTTACTTCCTTCACTTTTTATTTGTGTATATGCCATTATAGCAACATGTTTTACCTACAACTCTCTTTACTAA ATGTCGTCGAGACTTTCGCGTGGGACTTTTAATGGTGGCTTACTTTCCACCGAAGCTGGAACTATAGCTCGAGTGATTGCCGATGGCACGATAACATTGTCAGGGTACTTGGGTGAAAGTAAGCTCTTGAATGTTACCTTACTTCCTTCACTTTTTATTTGTGTATATGCCATTATAGCAACATGTTTTACCTACAACTCTCTTTACTAA MSSRLSRGTFNGGLLSTEAGTIARVIADGTITLSGYLGESKLLNVTLLPSLFICVYAIIATCFTYNSLY
BLAST of Cla006935 vs. Swiss-Prot
Match: SPXM2_ARATH (SPX domain-containing membrane protein At4g11810 OS=Arabidopsis thaliana GN=At4g11810 PE=3 SV=1) HSP 1 Score: 119.0 bits (297), Expect = 2.0e-26 Identity = 58/69 (84.06%), Postives = 63/69 (91.30%), Query Frame = 1
BLAST of Cla006935 vs. Swiss-Prot
Match: SPXM3_ARATH (SPX domain-containing membrane protein At4g22990 OS=Arabidopsis thaliana GN=At4g22990 PE=2 SV=2) HSP 1 Score: 115.5 bits (288), Expect = 2.2e-25 Identity = 56/69 (81.16%), Postives = 61/69 (88.41%), Query Frame = 1
BLAST of Cla006935 vs. Swiss-Prot
Match: SPXM1_ARATH (SPX domain-containing membrane protein At1g63010 OS=Arabidopsis thaliana GN=At1g63010 PE=2 SV=1) HSP 1 Score: 110.9 bits (276), Expect = 5.5e-24 Identity = 53/69 (76.81%), Postives = 58/69 (84.06%), Query Frame = 1
BLAST of Cla006935 vs. Swiss-Prot
Match: SPXM1_ORYSI (SPX domain-containing membrane protein OsI_08463 OS=Oryza sativa subsp. indica GN=OsI_08463 PE=3 SV=2) HSP 1 Score: 105.9 bits (263), Expect = 1.8e-22 Identity = 53/69 (76.81%), Postives = 58/69 (84.06%), Query Frame = 1
BLAST of Cla006935 vs. Swiss-Prot
Match: SPXM1_ORYSJ (SPX domain-containing membrane protein Os02g45520 OS=Oryza sativa subsp. japonica GN=Os02g0678200 PE=2 SV=1) HSP 1 Score: 105.9 bits (263), Expect = 1.8e-22 Identity = 53/69 (76.81%), Postives = 58/69 (84.06%), Query Frame = 1
BLAST of Cla006935 vs. TrEMBL
Match: A0A0A0K8X2_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_6G075110 PE=4 SV=1) HSP 1 Score: 134.4 bits (337), Expect = 5.2e-29 Identity = 67/69 (97.10%), Postives = 68/69 (98.55%), Query Frame = 1
BLAST of Cla006935 vs. TrEMBL
Match: A0A067H4T8_CITSI (Uncharacterized protein OS=Citrus sinensis GN=CISIN_1g005307mg PE=4 SV=1) HSP 1 Score: 126.3 bits (316), Expect = 1.4e-26 Identity = 61/69 (88.41%), Postives = 67/69 (97.10%), Query Frame = 1
BLAST of Cla006935 vs. TrEMBL
Match: A0A103XRC3_CYNCS (Major facilitator superfamily OS=Cynara cardunculus var. scolymus GN=Ccrd_002477 PE=4 SV=1) HSP 1 Score: 126.3 bits (316), Expect = 1.4e-26 Identity = 62/69 (89.86%), Postives = 66/69 (95.65%), Query Frame = 1
BLAST of Cla006935 vs. TrEMBL
Match: B9GW54_POPTR (SPX domain-containing family protein OS=Populus trichocarpa GN=POPTR_0003s12060g PE=4 SV=1) HSP 1 Score: 125.9 bits (315), Expect = 1.8e-26 Identity = 61/69 (88.41%), Postives = 67/69 (97.10%), Query Frame = 1
BLAST of Cla006935 vs. TrEMBL
Match: B9IC85_POPTR (Uncharacterized protein OS=Populus trichocarpa GN=POPTR_0014s07400g PE=4 SV=1) HSP 1 Score: 125.9 bits (315), Expect = 1.8e-26 Identity = 61/69 (88.41%), Postives = 68/69 (98.55%), Query Frame = 1
BLAST of Cla006935 vs. NCBI nr
Match: gi|659120367|ref|XP_008460157.1| (PREDICTED: LOW QUALITY PROTEIN: SPX domain-containing membrane protein At4g22990-like [Cucumis melo]) HSP 1 Score: 137.1 bits (344), Expect = 1.2e-29 Identity = 69/69 (100.00%), Postives = 69/69 (100.00%), Query Frame = 1
BLAST of Cla006935 vs. NCBI nr
Match: gi|778711074|ref|XP_011656680.1| (PREDICTED: SPX domain-containing membrane protein At4g22990-like isoform X1 [Cucumis sativus]) HSP 1 Score: 134.4 bits (337), Expect = 7.5e-29 Identity = 67/69 (97.10%), Postives = 68/69 (98.55%), Query Frame = 1
BLAST of Cla006935 vs. NCBI nr
Match: gi|700191006|gb|KGN46210.1| (hypothetical protein Csa_6G075110 [Cucumis sativus]) HSP 1 Score: 134.4 bits (337), Expect = 7.5e-29 Identity = 67/69 (97.10%), Postives = 68/69 (98.55%), Query Frame = 1
BLAST of Cla006935 vs. NCBI nr
Match: gi|778711080|ref|XP_011656682.1| (PREDICTED: SPX domain-containing membrane protein At4g22990-like isoform X2 [Cucumis sativus]) HSP 1 Score: 134.4 bits (337), Expect = 7.5e-29 Identity = 67/69 (97.10%), Postives = 68/69 (98.55%), Query Frame = 1
BLAST of Cla006935 vs. NCBI nr
Match: gi|778711084|ref|XP_011656683.1| (PREDICTED: SPX domain-containing membrane protein At4g22990-like isoform X3 [Cucumis sativus]) HSP 1 Score: 134.4 bits (337), Expect = 7.5e-29 Identity = 67/69 (97.10%), Postives = 68/69 (98.55%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of watermelon (97103)
Date Performed: 2016-09-28
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene: |