Cla006611 (gene) Watermelon (97103) v1
The following sequences are available for this feature:
Legend: polypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGCTAATGCTAATGCAAGTGTTTCTGAGAGAGAAAATTCTTGGAATTTGATTTCTTAGTCCTAATGGGTGTTGTTTTCTGGCCATAGGTGGTGGAACTGAAGGTCTTTTTGCATTGTGAGGAGTGCATCAAGAAGATTCTCAAAGCCATCAAGAAAATACAAGGTTTGTGTTCATTGTCTTTATCAATTTCTCCTGTGGTTTTAAGTTTAATAATCTTCAAAAGAATGAGTAAACCATTTGGGGATTTCGTTATTTTCTATTTTTCTTTCCTTCTCCATTGGCAGATATAGAAACATATAATGTAGATATACAGCTGAACAAGGTGACCGTCACAGGCAATGTCACTGAAGAAGAAGTCATCAAAGTTCTTCAGAAAATTAGGAAAACTGCAATTCCATGGCAAGGTGATGAAGTTGACAATCAAGTCGACAACATTAATTACTAG ATGGCTAATGCTAATGCAAGTGTGGTGGAACTGAAGGTCTTTTTGCATTGTGAGGAGTGCATCAAGAAGATTCTCAAAGCCATCAAGAAAATACAAGATATAGAAACATATAATGTAGATATACAGCTGAACAAGGTGACCGTCACAGGCAATGTCACTGAAGAAGAAGTCATCAAAGTTCTTCAGAAAATTAGGAAAACTGCAATTCCATGGCAAGGTGATGAAGTTGACAATCAAGTCGACAACATTAATTACTAG ATGGCTAATGCTAATGCAAGTGTGGTGGAACTGAAGGTCTTTTTGCATTGTGAGGAGTGCATCAAGAAGATTCTCAAAGCCATCAAGAAAATACAAGATATAGAAACATATAATGTAGATATACAGCTGAACAAGGTGACCGTCACAGGCAATGTCACTGAAGAAGAAGTCATCAAAGTTCTTCAGAAAATTAGGAAAACTGCAATTCCATGGCAAGGTGATGAAGTTGACAATCAAGTCGACAACATTAATTACTAG MANANASVVELKVFLHCEECIKKILKAIKKIQDIETYNVDIQLNKVTVTGNVTEEEVIKVLQKIRKTAIPWQGDEVDNQVDNINY
BLAST of Cla006611 vs. Swiss-Prot
Match: ATOX1_ARATH (Copper transport protein ATX1 OS=Arabidopsis thaliana GN=ATX1 PE=1 SV=2) HSP 1 Score: 51.6 bits (122), Expect = 4.9e-06 Identity = 22/69 (31.88%), Postives = 40/69 (57.97%), Query Frame = 1
BLAST of Cla006611 vs. Swiss-Prot
Match: CCH_ARATH (Copper transport protein CCH OS=Arabidopsis thaliana GN=CCH PE=1 SV=1) HSP 1 Score: 51.2 bits (121), Expect = 6.4e-06 Identity = 23/66 (34.85%), Postives = 37/66 (56.06%), Query Frame = 1
BLAST of Cla006611 vs. TrEMBL
Match: A0A0A0K8N1_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_6G013360 PE=4 SV=1) HSP 1 Score: 133.3 bits (334), Expect = 1.4e-28 Identity = 67/80 (83.75%), Postives = 73/80 (91.25%), Query Frame = 1
BLAST of Cla006611 vs. TrEMBL
Match: V4LKV1_EUTSA (Uncharacterized protein OS=Eutrema salsugineum GN=EUTSA_v10015175mg PE=4 SV=1) HSP 1 Score: 115.5 bits (288), Expect = 3.1e-23 Identity = 57/79 (72.15%), Postives = 69/79 (87.34%), Query Frame = 1
BLAST of Cla006611 vs. TrEMBL
Match: D7LYD7_ARALL (Metal ion binding protein OS=Arabidopsis lyrata subsp. lyrata GN=ARALYDRAFT_325171 PE=4 SV=1) HSP 1 Score: 113.6 bits (283), Expect = 1.2e-22 Identity = 54/69 (78.26%), Postives = 63/69 (91.30%), Query Frame = 1
BLAST of Cla006611 vs. TrEMBL
Match: A0A0K9RJ29_SPIOL (Uncharacterized protein OS=Spinacia oleracea GN=SOVF_066130 PE=4 SV=1) HSP 1 Score: 113.6 bits (283), Expect = 1.2e-22 Identity = 56/74 (75.68%), Postives = 62/74 (83.78%), Query Frame = 1
BLAST of Cla006611 vs. TrEMBL
Match: A0A087G506_ARAAL (Uncharacterized protein OS=Arabis alpina GN=AALP_AA8G047800 PE=4 SV=1) HSP 1 Score: 112.5 bits (280), Expect = 2.6e-22 Identity = 54/69 (78.26%), Postives = 62/69 (89.86%), Query Frame = 1
BLAST of Cla006611 vs. NCBI nr
Match: gi|449441276|ref|XP_004138408.1| (PREDICTED: copper transport protein ATX1 [Cucumis sativus]) HSP 1 Score: 133.3 bits (334), Expect = 2.0e-28 Identity = 67/80 (83.75%), Postives = 73/80 (91.25%), Query Frame = 1
BLAST of Cla006611 vs. NCBI nr
Match: gi|659113775|ref|XP_008456748.1| (PREDICTED: copper transport protein CCH [Cucumis melo]) HSP 1 Score: 131.0 bits (328), Expect = 1.0e-27 Identity = 62/73 (84.93%), Postives = 70/73 (95.89%), Query Frame = 1
BLAST of Cla006611 vs. NCBI nr
Match: gi|658016577|ref|XP_008343634.1| (PREDICTED: copper transport protein ATX1-like [Malus domestica]) HSP 1 Score: 115.9 bits (289), Expect = 3.4e-23 Identity = 58/69 (84.06%), Postives = 62/69 (89.86%), Query Frame = 1
BLAST of Cla006611 vs. NCBI nr
Match: gi|567170646|ref|XP_006399000.1| (hypothetical protein EUTSA_v10015175mg [Eutrema salsugineum]) HSP 1 Score: 115.5 bits (288), Expect = 4.4e-23 Identity = 57/79 (72.15%), Postives = 69/79 (87.34%), Query Frame = 1
BLAST of Cla006611 vs. NCBI nr
Match: gi|470144090|ref|XP_004307698.1| (PREDICTED: copper transport protein CCH isoform X2 [Fragaria vesca subsp. vesca]) HSP 1 Score: 114.0 bits (284), Expect = 1.3e-22 Identity = 58/74 (78.38%), Postives = 65/74 (87.84%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
This gene is associated with the following unigenes:
Analysis Name: InterPro Annotations of watermelon (97103)
Date Performed: 2016-09-28
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene: |