Cla003273 (gene) Watermelon (97103) v1
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGCTTCTGGCAGGTACTAGCACCAACCCTTTGTGTAAGATTGACACGAAGGAGCTTGGTGTGTGTCAACCAGCAGTGGCTCCTTGGCATGGAAAACCATTGCAACCACCAACTAAAGGTTGTTGTTCGGTGCTTCGTCGTGCCGATCTCAAGTGTTTGTGCAACTTCAAATCAATCCTCCCATCCATTGGGATTAATATAACCAATGCTTTGGCTTTGCCTTCCAAATGTGACATTAAAACTCCTCCAGAGTGTCATAATTAG ATGCTTCTGGCAGGTACTAGCACCAACCCTTTGTGTAAGATTGACACGAAGGAGCTTGGTGTGTGTCAACCAGCAGTGGCTCCTTGGCATGGAAAACCATTGCAACCACCAACTAAAGGTTGTTGTTCGGTGCTTCGTCGTGCCGATCTCAAGTGTTTGTGCAACTTCAAATCAATCCTCCCATCCATTGGGATTAATATAACCAATGCTTTGGCTTTGCCTTCCAAATGTGACATTAAAACTCCTCCAGAGTGTCATAATTAG ATGCTTCTGGCAGGTACTAGCACCAACCCTTTGTGTAAGATTGACACGAAGGAGCTTGGTGTGTGTCAACCAGCAGTGGCTCCTTGGCATGGAAAACCATTGCAACCACCAACTAAAGGTTGTTGTTCGGTGCTTCGTCGTGCCGATCTCAAGTGTTTGTGCAACTTCAAATCAATCCTCCCATCCATTGGGATTAATATAACCAATGCTTTGGCTTTGCCTTCCAAATGTGACATTAAAACTCCTCCAGAGTGTCATAATTAG MLLAGTSTNPLCKIDTKELGVCQPAVAPWHGKPLQPPTKGCCSVLRRADLKCLCNFKSILPSIGINITNALALPSKCDIKTPPECHN
BLAST of Cla003273 vs. Swiss-Prot
Match: DIRL1_ARATH (Putative lipid-transfer protein DIR1 OS=Arabidopsis thaliana GN=DIR1 PE=1 SV=1) HSP 1 Score: 54.3 bits (129), Expect = 7.7e-07 Identity = 30/87 (34.48%), Postives = 44/87 (50.57%), Query Frame = 1
BLAST of Cla003273 vs. TrEMBL
Match: A0A0A0LBB0_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_3G759990 PE=4 SV=1) HSP 1 Score: 137.9 bits (346), Expect = 5.9e-30 Identity = 65/85 (76.47%), Postives = 71/85 (83.53%), Query Frame = 1
BLAST of Cla003273 vs. TrEMBL
Match: A0A0A0LAS6_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_3G760500 PE=4 SV=1) HSP 1 Score: 119.4 bits (298), Expect = 2.2e-24 Identity = 54/88 (61.36%), Postives = 69/88 (78.41%), Query Frame = 1
BLAST of Cla003273 vs. TrEMBL
Match: C6T4Z3_SOYBN (Putative uncharacterized protein OS=Glycine max PE=2 SV=1) HSP 1 Score: 94.0 bits (232), Expect = 9.8e-17 Identity = 42/84 (50.00%), Postives = 59/84 (70.24%), Query Frame = 1
BLAST of Cla003273 vs. TrEMBL
Match: A0A059BVH1_EUCGR (Uncharacterized protein OS=Eucalyptus grandis GN=EUGRSUZ_F03514 PE=4 SV=1) HSP 1 Score: 94.0 bits (232), Expect = 9.8e-17 Identity = 41/86 (47.67%), Postives = 55/86 (63.95%), Query Frame = 1
BLAST of Cla003273 vs. TrEMBL
Match: K7MTB4_SOYBN (Uncharacterized protein OS=Glycine max GN=GLYMA_18G191800 PE=4 SV=1) HSP 1 Score: 94.0 bits (232), Expect = 9.8e-17 Identity = 42/84 (50.00%), Postives = 59/84 (70.24%), Query Frame = 1
BLAST of Cla003273 vs. NCBI nr
Match: gi|659093748|ref|XP_008447696.1| (PREDICTED: putative lipid-transfer protein DIR1 [Cucumis melo]) HSP 1 Score: 143.7 bits (361), Expect = 1.5e-31 Identity = 67/85 (78.82%), Postives = 73/85 (85.88%), Query Frame = 1
BLAST of Cla003273 vs. NCBI nr
Match: gi|700203945|gb|KGN59078.1| (hypothetical protein Csa_3G759990 [Cucumis sativus]) HSP 1 Score: 137.9 bits (346), Expect = 8.5e-30 Identity = 65/85 (76.47%), Postives = 71/85 (83.53%), Query Frame = 1
BLAST of Cla003273 vs. NCBI nr
Match: gi|449465073|ref|XP_004150253.1| (PREDICTED: putative lipid-transfer protein DIR1 [Cucumis sativus]) HSP 1 Score: 119.4 bits (298), Expect = 3.1e-24 Identity = 54/88 (61.36%), Postives = 69/88 (78.41%), Query Frame = 1
BLAST of Cla003273 vs. NCBI nr
Match: gi|659093746|ref|XP_008447695.1| (PREDICTED: putative lipid-transfer protein DIR1 [Cucumis melo]) HSP 1 Score: 115.5 bits (288), Expect = 4.5e-23 Identity = 57/89 (64.04%), Postives = 66/89 (74.16%), Query Frame = 1
BLAST of Cla003273 vs. NCBI nr
Match: gi|694423146|ref|XP_009339389.1| (PREDICTED: putative lipid-transfer protein DIR1 [Pyrus x bretschneideri]) HSP 1 Score: 103.6 bits (257), Expect = 1.8e-19 Identity = 48/85 (56.47%), Postives = 64/85 (75.29%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
This gene is associated with the following unigenes:
Analysis Name: InterPro Annotations of watermelon (97103)
Date Performed: 2016-09-28
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|