Cla002629 (gene) Watermelon (97103) v1
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGATACTGCCCTCGGAGCAGGTGGAGTAAGCGACGGAGGATTTTCTCCGATGAACGACGACATTCTTCACAACATCTTCGGCCGGCTTCCTGCTCAATCCTTCGCAGCAGCGGCCTACGTTTGTAAAACTTGGAACTCTGTTTGCAATCGGATCCTCTGCCGCCCTAAATTCTCCTCCGCCGTGTCCCTGAATCCCTCTCTTCACGTTCGCCTCGTTTCTCTTTTTCTTTATTTGGTCAATTAG ATGGATACTGCCCTCGGAGCAGGTGGAGTAAGCGACGGAGGATTTTCTCCGATGAACGACGACATTCTTCACAACATCTTCGGCCGGCTTCCTGCTCAATCCTTCGCAGCAGCGGCCTACGTTTGTAAAACTTGGAACTCTGTTTGCAATCGGATCCTCTGCCGCCCTAAATTCTCCTCCGCCGTGTCCCTGAATCCCTCTCTTCACGTTCGCCTCGTTTCTCTTTTTCTTTATTTGGTCAATTAG ATGGATACTGCCCTCGGAGCAGGTGGAGTAAGCGACGGAGGATTTTCTCCGATGAACGACGACATTCTTCACAACATCTTCGGCCGGCTTCCTGCTCAATCCTTCGCAGCAGCGGCCTACGTTTGTAAAACTTGGAACTCTGTTTGCAATCGGATCCTCTGCCGCCCTAAATTCTCCTCCGCCGTGTCCCTGAATCCCTCTCTTCACGTTCGCCTCGTTTCTCTTTTTCTTTATTTGGTCAATTAG MDTALGAGGVSDGGFSPMNDDILHNIFGRLPAQSFAAAAYVCKTWNSVCNRILCRPKFSSAVSLNPSLHVRLVSLFLYLVN
BLAST of Cla002629 vs. Swiss-Prot
Match: FBL91_ARATH (F-box/LRR-repeat protein At5g63520 OS=Arabidopsis thaliana GN=At5g63520 PE=2 SV=1) HSP 1 Score: 66.2 bits (160), Expect = 1.8e-10 Identity = 32/49 (65.31%), Postives = 36/49 (73.47%), Query Frame = 1
BLAST of Cla002629 vs. TrEMBL
Match: A0A061FY98_THECC (F-box family protein, putative isoform 3 OS=Theobroma cacao GN=TCM_014665 PE=4 SV=1) HSP 1 Score: 80.9 bits (198), Expect = 8.0e-13 Identity = 39/63 (61.90%), Postives = 45/63 (71.43%), Query Frame = 1
BLAST of Cla002629 vs. TrEMBL
Match: A0A061G007_THECC (F-box family protein, putative isoform 2 OS=Theobroma cacao GN=TCM_014665 PE=4 SV=1) HSP 1 Score: 80.9 bits (198), Expect = 8.0e-13 Identity = 39/63 (61.90%), Postives = 45/63 (71.43%), Query Frame = 1
BLAST of Cla002629 vs. TrEMBL
Match: A0A061G647_THECC (F-box family protein, putative isoform 4 (Fragment) OS=Theobroma cacao GN=TCM_014665 PE=4 SV=1) HSP 1 Score: 80.9 bits (198), Expect = 8.0e-13 Identity = 39/63 (61.90%), Postives = 45/63 (71.43%), Query Frame = 1
BLAST of Cla002629 vs. TrEMBL
Match: A0A061FZ19_THECC (F-box family protein, putative isoform 1 OS=Theobroma cacao GN=TCM_014665 PE=4 SV=1) HSP 1 Score: 80.9 bits (198), Expect = 8.0e-13 Identity = 39/63 (61.90%), Postives = 45/63 (71.43%), Query Frame = 1
BLAST of Cla002629 vs. TrEMBL
Match: M5WDG3_PRUPE (Uncharacterized protein OS=Prunus persica GN=PRUPE_ppa004403mg PE=4 SV=1) HSP 1 Score: 79.0 bits (193), Expect = 3.0e-12 Identity = 36/55 (65.45%), Postives = 45/55 (81.82%), Query Frame = 1
BLAST of Cla002629 vs. NCBI nr
Match: gi|502133306|ref|XP_004501713.1| (PREDICTED: F-box/LRR-repeat protein At5g63520 [Cicer arietinum]) HSP 1 Score: 82.0 bits (201), Expect = 5.2e-13 Identity = 38/57 (66.67%), Postives = 47/57 (82.46%), Query Frame = 1
BLAST of Cla002629 vs. NCBI nr
Match: gi|590670289|ref|XP_007038013.1| (F-box family protein, putative isoform 4, partial [Theobroma cacao]) HSP 1 Score: 80.9 bits (198), Expect = 1.1e-12 Identity = 39/63 (61.90%), Postives = 45/63 (71.43%), Query Frame = 1
BLAST of Cla002629 vs. NCBI nr
Match: gi|590670285|ref|XP_007038012.1| (F-box family protein, putative isoform 3 [Theobroma cacao]) HSP 1 Score: 80.9 bits (198), Expect = 1.1e-12 Identity = 39/63 (61.90%), Postives = 45/63 (71.43%), Query Frame = 1
BLAST of Cla002629 vs. NCBI nr
Match: gi|590670281|ref|XP_007038011.1| (F-box family protein, putative isoform 2 [Theobroma cacao]) HSP 1 Score: 80.9 bits (198), Expect = 1.1e-12 Identity = 39/63 (61.90%), Postives = 45/63 (71.43%), Query Frame = 1
BLAST of Cla002629 vs. NCBI nr
Match: gi|590670277|ref|XP_007038010.1| (F-box family protein, putative isoform 1 [Theobroma cacao]) HSP 1 Score: 80.9 bits (198), Expect = 1.1e-12 Identity = 39/63 (61.90%), Postives = 45/63 (71.43%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of watermelon (97103)
Date Performed: 2016-09-28
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene: |