ClCG08G002680 (gene) Watermelon (Charleston Gray)
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGCCATCCAACCACATTCTCCTCTTGAGCTTGAGCCATGGAATGACTTGAACGGCAAAGTGGCAATGGTGATCGAAGCCTCATCAGGGATAAGTCGTGAGATCTGTCTTAATCTTGCCAAAGCTGGATGTAAAATTATCGCCGTTGCACGTCGTATGGATAGACTCCAATCTCTTGCGTGACGAAGTTAATCGACATGATTTCTCAGCTTCCTCATCGGTCTCTTCCAGCTCTCGAGCCTCTTTCACAATGGTGATGGAGAGTCGCTGAGATGTGGCTGTGGAACTTGA ATGGCCATCCAACCACATTCTCCTCTTGAGCTTGAGCCATGGAATGACTTGAACGGCAAAGTGGCAATGGTGATCGAAGCCTCATCAGGGATAAGTCGTGAGATCTGTCTTAATCTTGCCAAAGCTGGATGTAAAATTATCGCCGTTGCACGTCGTATGGATAGACTCCAATCTCTTGCCTTCCTCATCGGTCTCTTCCAGCTCTCGAGCCTCTTTCACAATGGTGATGGAGAGTCGCTGAGATGTGGCTGTGGAACTTGA ATGGCCATCCAACCACATTCTCCTCTTGAGCTTGAGCCATGGAATGACTTGAACGGCAAAGTGGCAATGGTGATCGAAGCCTCATCAGGGATAAGTCGTGAGATCTGTCTTAATCTTGCCAAAGCTGGATGTAAAATTATCGCCGTTGCACGTCGTATGGATAGACTCCAATCTCTTGCCTTCCTCATCGGTCTCTTCCAGCTCTCGAGCCTCTTTCACAATGGTGATGGAGAGTCGCTGAGATGTGGCTGTGGAACTTGA MAIQPHSPLELEPWNDLNGKVAMVIEASSGISREICLNLAKAGCKIIAVARRMDRLQSLAFLIGLFQLSSLFHNGDGESLRCGCGT
BLAST of ClCG08G002680 vs. TrEMBL
Match: A0A0A0L258_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_4G427280 PE=3 SV=1) HSP 1 Score: 95.5 bits (236), Expect = 3.3e-17 Identity = 46/59 (77.97%), Postives = 50/59 (84.75%), Query Frame = 1
BLAST of ClCG08G002680 vs. TrEMBL
Match: A0A0A0L3H9_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_4G429300 PE=4 SV=1) HSP 1 Score: 94.7 bits (234), Expect = 5.7e-17 Identity = 48/71 (67.61%), Postives = 53/71 (74.65%), Query Frame = 1
BLAST of ClCG08G002680 vs. TrEMBL
Match: A0A0A0LCR1_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_3G824880 PE=3 SV=1) HSP 1 Score: 88.6 bits (218), Expect = 4.1e-15 Identity = 44/59 (74.58%), Postives = 50/59 (84.75%), Query Frame = 1
BLAST of ClCG08G002680 vs. TrEMBL
Match: A0A0A0L3H5_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_4G427270 PE=3 SV=1) HSP 1 Score: 86.7 bits (213), Expect = 1.5e-14 Identity = 44/70 (62.86%), Postives = 50/70 (71.43%), Query Frame = 1
BLAST of ClCG08G002680 vs. TrEMBL
Match: D7KUN9_ARALL (Predicted protein OS=Arabidopsis lyrata subsp. lyrata GN=ARALYDRAFT_675111 PE=3 SV=1) HSP 1 Score: 82.8 bits (203), Expect = 2.2e-13 Identity = 40/62 (64.52%), Postives = 48/62 (77.42%), Query Frame = 1
BLAST of ClCG08G002680 vs. TAIR10
Match: AT3G46170.1 (AT3G46170.1 NAD(P)-binding Rossmann-fold superfamily protein) HSP 1 Score: 73.9 bits (180), Expect = 5.3e-14 Identity = 36/50 (72.00%), Postives = 39/50 (78.00%), Query Frame = 1
BLAST of ClCG08G002680 vs. TAIR10
Match: AT3G55310.1 (AT3G55310.1 NAD(P)-binding Rossmann-fold superfamily protein) HSP 1 Score: 73.6 bits (179), Expect = 6.9e-14 Identity = 36/62 (58.06%), Postives = 43/62 (69.35%), Query Frame = 1
BLAST of ClCG08G002680 vs. TAIR10
Match: AT1G63380.1 (AT1G63380.1 NAD(P)-binding Rossmann-fold superfamily protein) HSP 1 Score: 73.2 bits (178), Expect = 9.0e-14 Identity = 36/57 (63.16%), Postives = 40/57 (70.18%), Query Frame = 1
BLAST of ClCG08G002680 vs. TAIR10
Match: AT1G62610.4 (AT1G62610.4 NAD(P)-binding Rossmann-fold superfamily protein) HSP 1 Score: 73.2 bits (178), Expect = 9.0e-14 Identity = 36/57 (63.16%), Postives = 40/57 (70.18%), Query Frame = 1
BLAST of ClCG08G002680 vs. TAIR10
Match: AT3G55290.1 (AT3G55290.1 NAD(P)-binding Rossmann-fold superfamily protein) HSP 1 Score: 72.8 bits (177), Expect = 1.2e-13 Identity = 36/61 (59.02%), Postives = 42/61 (68.85%), Query Frame = 1
BLAST of ClCG08G002680 vs. NCBI nr
Match: gi|778697737|ref|XP_011654387.1| (PREDICTED: L-xylulose reductase-like [Cucumis sativus]) HSP 1 Score: 95.5 bits (236), Expect = 4.8e-17 Identity = 46/59 (77.97%), Postives = 50/59 (84.75%), Query Frame = 1
BLAST of ClCG08G002680 vs. NCBI nr
Match: gi|700199534|gb|KGN54692.1| (hypothetical protein Csa_4G427280 [Cucumis sativus]) HSP 1 Score: 95.5 bits (236), Expect = 4.8e-17 Identity = 46/59 (77.97%), Postives = 50/59 (84.75%), Query Frame = 1
BLAST of ClCG08G002680 vs. NCBI nr
Match: gi|778697741|ref|XP_011654389.1| (PREDICTED: dehydrogenase/reductase SDR family protein 7-like [Cucumis sativus]) HSP 1 Score: 94.7 bits (234), Expect = 8.2e-17 Identity = 48/71 (67.61%), Postives = 53/71 (74.65%), Query Frame = 1
BLAST of ClCG08G002680 vs. NCBI nr
Match: gi|700199538|gb|KGN54696.1| (hypothetical protein Csa_4G429300 [Cucumis sativus]) HSP 1 Score: 94.7 bits (234), Expect = 8.2e-17 Identity = 48/71 (67.61%), Postives = 53/71 (74.65%), Query Frame = 1
BLAST of ClCG08G002680 vs. NCBI nr
Match: gi|659111577|ref|XP_008455802.1| (PREDICTED: probable L-xylulose reductase [Cucumis melo]) HSP 1 Score: 93.2 bits (230), Expect = 2.4e-16 Identity = 47/71 (66.20%), Postives = 53/71 (74.65%), Query Frame = 1
The following BLAST results are available for this feature:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of watermelon (Charleston Gray)
Date Performed: 2016-09-28
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|