ClCG05G011050 (gene) Watermelon (Charleston Gray)
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGAGAGTGGTGGATGATGTGAAGAAATACATGATCTATGAACTTGTTGGAGGAGATGAACTTGAAGTAAAGGGTAAAACTTGAAGTACTTAATGGAGGGTTGAACAAAGTAGGAGGAAGCTTTGCAAAATGGACTATTGAGTTTGAAAAGACAAATGAAAATGTGCCTTCACCAGAAAGCTACTTGGGATTGTTTTCTAAGATTTCCAAAGCCATTGATGCTTATTTTTCCAAGAATAACTAA ATGAGAGTGGTGGATGATGTGAAGAAATACATGATCTATGAACTTGTTGGAGGAGATGAACTTGAAGTAAAGGTACTTAATGGAGGGTTGAACAAAGTAGGAGGAAGCTTTGCAAAATGGACTATTGAGTTTGAAAAGACAAATGAAAATGTGCCTTCACCAGAAAGCTACTTGGGATTGTTTTCTAAGATTTCCAAAGCCATTGATGCTTATTTTTCCAAGAATAACTAA ATGAGAGTGGTGGATGATGTGAAGAAATACATGATCTATGAACTTGTTGGAGGAGATGAACTTGAAGTAAAGGTACTTAATGGAGGGTTGAACAAAGTAGGAGGAAGCTTTGCAAAATGGACTATTGAGTTTGAAAAGACAAATGAAAATGTGCCTTCACCAGAAAGCTACTTGGGATTGTTTTCTAAGATTTCCAAAGCCATTGATGCTTATTTTTCCAAGAATAACTAA MRVVDDVKKYMIYELVGGDELEVKVLNGGLNKVGGSFAKWTIEFEKTNENVPSPESYLGLFSKISKAIDAYFSKNN
BLAST of ClCG05G011050 vs. TrEMBL
Match: A0A0A0LA34_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_3G342860 PE=4 SV=1) HSP 1 Score: 102.4 bits (254), Expect = 2.4e-19 Identity = 49/83 (59.04%), Postives = 63/83 (75.90%), Query Frame = 1
BLAST of ClCG05G011050 vs. TrEMBL
Match: N0DKL1_CUCPE (Major latex-like protein OS=Cucurbita pepo subsp. ovifera GN=MLP-PG1 PE=2 SV=1) HSP 1 Score: 100.9 bits (250), Expect = 7.0e-19 Identity = 52/84 (61.90%), Postives = 64/84 (76.19%), Query Frame = 1
BLAST of ClCG05G011050 vs. TrEMBL
Match: A0A0A0LCN2_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_3G340350 PE=4 SV=1) HSP 1 Score: 100.9 bits (250), Expect = 7.0e-19 Identity = 51/84 (60.71%), Postives = 65/84 (77.38%), Query Frame = 1
BLAST of ClCG05G011050 vs. TrEMBL
Match: N0DK19_CUCPE (Major latex-like protein OS=Cucurbita pepo subsp. pepo GN=MLP-GR1 PE=2 SV=1) HSP 1 Score: 99.0 bits (245), Expect = 2.7e-18 Identity = 51/84 (60.71%), Postives = 63/84 (75.00%), Query Frame = 1
BLAST of ClCG05G011050 vs. TrEMBL
Match: N0DK07_CUCPE (Major latex-like protein OS=Cucurbita pepo subsp. pepo GN=MLP-GR3 PE=2 SV=1) HSP 1 Score: 89.7 bits (221), Expect = 1.6e-15 Identity = 48/84 (57.14%), Postives = 59/84 (70.24%), Query Frame = 1
BLAST of ClCG05G011050 vs. TAIR10
Match: AT5G28010.1 (AT5G28010.1 Polyketide cyclase/dehydrase and lipid transport superfamily protein) HSP 1 Score: 47.4 bits (111), Expect = 4.7e-06 Identity = 27/81 (33.33%), Postives = 42/81 (51.85%), Query Frame = 1
BLAST of ClCG05G011050 vs. NCBI nr
Match: gi|449464144|ref|XP_004149789.1| (PREDICTED: MLP-like protein 34 [Cucumis sativus]) HSP 1 Score: 102.4 bits (254), Expect = 3.5e-19 Identity = 49/83 (59.04%), Postives = 63/83 (75.90%), Query Frame = 1
BLAST of ClCG05G011050 vs. NCBI nr
Match: gi|659114461|ref|XP_008457062.1| (PREDICTED: MLP-like protein 423 [Cucumis melo]) HSP 1 Score: 102.1 bits (253), Expect = 4.5e-19 Identity = 48/83 (57.83%), Postives = 64/83 (77.11%), Query Frame = 1
BLAST of ClCG05G011050 vs. NCBI nr
Match: gi|778688602|ref|XP_011652791.1| (PREDICTED: uncharacterized protein LOC105435098 [Cucumis sativus]) HSP 1 Score: 100.9 bits (250), Expect = 1.0e-18 Identity = 51/84 (60.71%), Postives = 65/84 (77.38%), Query Frame = 1
BLAST of ClCG05G011050 vs. NCBI nr
Match: gi|477504342|dbj|BAN14688.1| (major latex-like protein [Cucurbita pepo subsp. ovifera]) HSP 1 Score: 100.9 bits (250), Expect = 1.0e-18 Identity = 52/84 (61.90%), Postives = 64/84 (76.19%), Query Frame = 1
BLAST of ClCG05G011050 vs. NCBI nr
Match: gi|477504344|dbj|BAN14689.1| (major latex-like protein [Cucurbita pepo subsp. pepo]) HSP 1 Score: 99.0 bits (245), Expect = 3.8e-18 Identity = 51/84 (60.71%), Postives = 63/84 (75.00%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of watermelon (Charleston Gray)
Date Performed: 2016-09-28
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|