ClCG02G010380 (gene) Watermelon (Charleston Gray)
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGCAGAATCAGGCGGCGGCGGCTACAAAGTCATTGGCTGTGGTTGCGCCGTTCCCTGCCCCCACGGCATCGCTTGCAGGTATGCGACTGCAAAGGCACCGGTGGGAGTAGAGATGGCGCAGTGGAGATGCCCATGCGGGGAGTACTGTGACTGTAACCCCTGCACGTGTCCCGGTACGGAAAGGATAATTGCAGCTGCGGCGAGAATTGCCGGTGTGAAACATGAGAGTTTGGATGAAACCAAATACGAAAACGACGACGTTTTGGCCTGA ATGGCAGAATCAGGCGGCGGCGGCTACAAAGTCATTGGCTGTGGTTGCGCCGTTCCCTGCCCCCACGGCATCGCTTGCAGGTATGCGACTGCAAAGGCACCGGTGGGAGTAGAGATGGCGCAGTGGAGATGCCCATGCGGGGAGTACTGTGACTGTAACCCCTGCACGTGTCCCGGTACGGAAAGGATAATTGCAGCTGCGGCGAGAATTGCCGGTGTGAAACATGAGAGTTTGGATGAAACCAAATACGAAAACGACGACGTTTTGGCCTGA ATGGCAGAATCAGGCGGCGGCGGCTACAAAGTCATTGGCTGTGGTTGCGCCGTTCCCTGCCCCCACGGCATCGCTTGCAGGTATGCGACTGCAAAGGCACCGGTGGGAGTAGAGATGGCGCAGTGGAGATGCCCATGCGGGGAGTACTGTGACTGTAACCCCTGCACGTGTCCCGGTACGGAAAGGATAATTGCAGCTGCGGCGAGAATTGCCGGTGTGAAACATGAGAGTTTGGATGAAACCAAATACGAAAACGACGACGTTTTGGCCTGA MAESGGGGYKVIGCGCAVPCPHGIACRYATAKAPVGVEMAQWRCPCGEYCDCNPCTCPGTERIIAAAARIAGVKHESLDETKYENDDVLA
BLAST of ClCG02G010380 vs. Swiss-Prot
Match: MT4A_ARATH (Metallothionein-like protein 4A OS=Arabidopsis thaliana GN=MT4A PE=2 SV=2) HSP 1 Score: 63.9 bits (154), Expect = 1.0e-09 Identity = 32/76 (42.11%), Postives = 38/76 (50.00%), Query Frame = 1
BLAST of ClCG02G010380 vs. Swiss-Prot
Match: MT4B_ARATH (Metallothionein-like protein 4B OS=Arabidopsis thaliana GN=MT4B PE=2 SV=2) HSP 1 Score: 62.8 bits (151), Expect = 2.3e-09 Identity = 29/75 (38.67%), Postives = 34/75 (45.33%), Query Frame = 1
BLAST of ClCG02G010380 vs. Swiss-Prot
Match: EC3_WHEAT (EC protein III OS=Triticum aestivum PE=2 SV=2) HSP 1 Score: 57.0 bits (136), Expect = 1.2e-07 Identity = 22/44 (50.00%), Postives = 24/44 (54.55%), Query Frame = 1
BLAST of ClCG02G010380 vs. Swiss-Prot
Match: EC1_WHEAT (EC protein I/II OS=Triticum aestivum PE=1 SV=2) HSP 1 Score: 56.6 bits (135), Expect = 1.6e-07 Identity = 22/44 (50.00%), Postives = 24/44 (54.55%), Query Frame = 1
BLAST of ClCG02G010380 vs. Swiss-Prot
Match: EC_MAIZE (EC protein homolog OS=Zea mays PE=3 SV=2) HSP 1 Score: 55.8 bits (133), Expect = 2.8e-07 Identity = 22/44 (50.00%), Postives = 25/44 (56.82%), Query Frame = 1
BLAST of ClCG02G010380 vs. TrEMBL
Match: A0A0A0KFY0_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_6G118310 PE=4 SV=1) HSP 1 Score: 87.4 bits (215), Expect = 9.5e-15 Identity = 41/67 (61.19%), Postives = 44/67 (65.67%), Query Frame = 1
BLAST of ClCG02G010380 vs. TrEMBL
Match: Q9ZTM1_PETHY (PGPS/NH21 OS=Petunia hybrida GN=PGPS/NH21 PE=2 SV=1) HSP 1 Score: 71.2 bits (173), Expect = 7.0e-10 Identity = 29/58 (50.00%), Postives = 37/58 (63.79%), Query Frame = 1
BLAST of ClCG02G010380 vs. TrEMBL
Match: A0A068TTG8_COFCA (Uncharacterized protein OS=Coffea canephora GN=GSCOC_T00022793001 PE=4 SV=1) HSP 1 Score: 68.6 bits (166), Expect = 4.6e-09 Identity = 25/46 (54.35%), Postives = 30/46 (65.22%), Query Frame = 1
BLAST of ClCG02G010380 vs. TrEMBL
Match: A0A022RJ84_ERYGU (Uncharacterized protein OS=Erythranthe guttata GN=MIMGU_mgv1a017202mg PE=4 SV=1) HSP 1 Score: 66.2 bits (160), Expect = 2.3e-08 Identity = 27/50 (54.00%), Postives = 33/50 (66.00%), Query Frame = 1
BLAST of ClCG02G010380 vs. TrEMBL
Match: K4B484_SOLLC (Uncharacterized protein OS=Solanum lycopersicum PE=4 SV=1) HSP 1 Score: 65.1 bits (157), Expect = 5.0e-08 Identity = 28/56 (50.00%), Postives = 34/56 (60.71%), Query Frame = 1
BLAST of ClCG02G010380 vs. TAIR10
Match: AT2G42000.2 (AT2G42000.2 Plant EC metallothionein-like protein, family 15) HSP 1 Score: 63.9 bits (154), Expect = 5.7e-11 Identity = 32/76 (42.11%), Postives = 38/76 (50.00%), Query Frame = 1
BLAST of ClCG02G010380 vs. TAIR10
Match: AT2G23240.1 (AT2G23240.1 Plant EC metallothionein-like protein, family 15) HSP 1 Score: 62.8 bits (151), Expect = 1.3e-10 Identity = 29/75 (38.67%), Postives = 34/75 (45.33%), Query Frame = 1
BLAST of ClCG02G010380 vs. NCBI nr
Match: gi|659095117|ref|XP_008448405.1| (PREDICTED: EC protein homolog 1-like [Cucumis melo]) HSP 1 Score: 87.4 bits (215), Expect = 1.4e-14 Identity = 41/67 (61.19%), Postives = 44/67 (65.67%), Query Frame = 1
BLAST of ClCG02G010380 vs. NCBI nr
Match: gi|778722096|ref|XP_011658404.1| (PREDICTED: EC protein homolog 1-like [Cucumis sativus]) HSP 1 Score: 87.4 bits (215), Expect = 1.4e-14 Identity = 41/67 (61.19%), Postives = 44/67 (65.67%), Query Frame = 1
BLAST of ClCG02G010380 vs. NCBI nr
Match: gi|4105810|gb|AAD02561.1| (PGPS/NH21 [Petunia x hybrida]) HSP 1 Score: 71.2 bits (173), Expect = 1.0e-09 Identity = 29/58 (50.00%), Postives = 37/58 (63.79%), Query Frame = 1
BLAST of ClCG02G010380 vs. NCBI nr
Match: gi|661898666|emb|CDO98633.1| (unnamed protein product [Coffea canephora]) HSP 1 Score: 68.6 bits (166), Expect = 6.6e-09 Identity = 25/46 (54.35%), Postives = 30/46 (65.22%), Query Frame = 1
BLAST of ClCG02G010380 vs. NCBI nr
Match: gi|672177994|ref|XP_008809112.1| (PREDICTED: EC protein homolog [Phoenix dactylifera]) HSP 1 Score: 67.8 bits (164), Expect = 1.1e-08 Identity = 27/47 (57.45%), Postives = 32/47 (68.09%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of watermelon (Charleston Gray)
Date Performed: 2016-09-28
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|