Carg26711 (gene) Silver-seed gourd
The following sequences are available for this feature:
Legend: polypeptideexonCDS Hold the cursor over a type above to highlight its positions in the sequence below.AAAACTCTTGGCCGTCAAAAGATCGAAATCAAGAAGTTAGAGAAGAAGAGCAGCAAACAAGTGACCTTTTCGAAGCGTCGTGCCCGACTTTTCAAGAAGGTCGGTGAGCTTTCTGTGCTTTGCGGAGCAGAGGTTGCCATCATTGGCTTCTCTCCGAACGATAAGGTTTTTTTTGTTTTGGTCATCCGAATGTTGACGTGCTTTTGGATCGGTATTTGACTCGAAATTTGTCGCCGCTGAAGCCGGCGGAGAATTTCGTTCCTGTAACTGAGTTTAATCGCGATTTCGCCGATTTAGTGTTGAAGTTCGAAGTGGCGAAGAAGTGA AAAACTCTTGGCCGTCAAAAGATCGAAATCAAGAAGTTAGAGAAGAAGAGCAGCAAACAAGTGACCTTTTCGAAGCGTCGTGCCCGACTTTTCAAGAAGGTCGGTGAGCTTTCTGTGCTTTGCGGAGCAGAGGTTGCCATCATTGGCTTCTCTCCGAACGATAAGCCGGCGGAGAATTTCGTTCCTGTAACTGAGTTTAATCGCGATTTCGCCGATTTAGTGTTGAAGTTCGAAGTGGCGAAGAAGTGA AAAACTCTTGGCCGTCAAAAGATCGAAATCAAGAAGTTAGAGAAGAAGAGCAGCAAACAAGTGACCTTTTCGAAGCGTCGTGCCCGACTTTTCAAGAAGGTCGGTGAGCTTTCTGTGCTTTGCGGAGCAGAGGTTGCCATCATTGGCTTCTCTCCGAACGATAAGCCGGCGGAGAATTTCGTTCCTGTAACTGAGTTTAATCGCGATTTCGCCGATTTAGTGTTGAAGTTCGAAGTGGCGAAGAAGTGA KTLGRQKIEIKKLEKKSSKQVTFSKRRARLFKKVGELSVLCGAEVAIIGFSPNDKPAENFVPVTEFNRDFADLVLKFEVAKK
BLAST of Carg26711 vs. NCBI nr
Match: XP_022959356.1 (agamous-like MADS-box protein AGL62 [Cucurbita moschata]) HSP 1 Score: 125.9 bits (315), Expect = 6.1e-26 Identity = 73/107 (68.22%), Postives = 76/107 (71.03%), Query Frame = 0
BLAST of Carg26711 vs. NCBI nr
Match: XP_023006252.1 (agamous-like MADS-box protein AGL62 [Cucurbita maxima]) HSP 1 Score: 125.9 bits (315), Expect = 6.1e-26 Identity = 73/107 (68.22%), Postives = 76/107 (71.03%), Query Frame = 0
BLAST of Carg26711 vs. NCBI nr
Match: XP_023549141.1 (agamous-like MADS-box protein AGL62 [Cucurbita pepo subsp. pepo]) HSP 1 Score: 125.9 bits (315), Expect = 6.1e-26 Identity = 73/107 (68.22%), Postives = 76/107 (71.03%), Query Frame = 0
BLAST of Carg26711 vs. NCBI nr
Match: XP_008466532.1 (PREDICTED: agamous-like MADS-box protein AGL62 [Cucumis melo]) HSP 1 Score: 122.5 bits (306), Expect = 6.8e-25 Identity = 70/107 (65.42%), Postives = 74/107 (69.16%), Query Frame = 0
BLAST of Carg26711 vs. NCBI nr
Match: KGN59988.1 (hypothetical protein Csa_3G860240 [Cucumis sativus]) HSP 1 Score: 122.1 bits (305), Expect = 8.8e-25 Identity = 70/107 (65.42%), Postives = 74/107 (69.16%), Query Frame = 0
BLAST of Carg26711 vs. TAIR10
Match: AT2G24840.1 (AGAMOUS-like 61) HSP 1 Score: 68.6 bits (166), Expect = 2.1e-12 Identity = 35/56 (62.50%), Postives = 44/56 (78.57%), Query Frame = 0
BLAST of Carg26711 vs. TAIR10
Match: AT1G17310.1 (MADS-box transcription factor family protein) HSP 1 Score: 66.2 bits (160), Expect = 1.0e-11 Identity = 35/54 (64.81%), Postives = 44/54 (81.48%), Query Frame = 0
BLAST of Carg26711 vs. TAIR10
Match: AT5G60440.1 (AGAMOUS-like 62) HSP 1 Score: 66.2 bits (160), Expect = 1.0e-11 Identity = 35/55 (63.64%), Postives = 43/55 (78.18%), Query Frame = 0
BLAST of Carg26711 vs. TAIR10
Match: AT3G66656.1 (AGAMOUS-like 91) HSP 1 Score: 65.1 bits (157), Expect = 2.3e-11 Identity = 36/75 (48.00%), Postives = 51/75 (68.00%), Query Frame = 0
BLAST of Carg26711 vs. TAIR10
Match: AT1G72350.1 (MADS-box transcription factor family protein) HSP 1 Score: 64.7 bits (156), Expect = 3.0e-11 Identity = 34/54 (62.96%), Postives = 43/54 (79.63%), Query Frame = 0
BLAST of Carg26711 vs. Swiss-Prot
Match: sp|Q4PSU4|AGL61_ARATH (Agamous-like MADS-box protein AGL61 OS=Arabidopsis thaliana OX=3702 GN=AGL61 PE=1 SV=1) HSP 1 Score: 68.6 bits (166), Expect = 3.8e-11 Identity = 35/56 (62.50%), Postives = 44/56 (78.57%), Query Frame = 0
BLAST of Carg26711 vs. Swiss-Prot
Match: sp|Q9FKK2|AGL62_ARATH (Agamous-like MADS-box protein AGL62 OS=Arabidopsis thaliana OX=3702 GN=AGL62 PE=1 SV=1) HSP 1 Score: 66.2 bits (160), Expect = 1.9e-10 Identity = 35/55 (63.64%), Postives = 43/55 (78.18%), Query Frame = 0
BLAST of Carg26711 vs. Swiss-Prot
Match: sp|Q39295|AGL15_BRANA (Agamous-like MADS-box protein AGL15 OS=Brassica napus OX=3708 GN=AGL15 PE=3 SV=1) HSP 1 Score: 64.7 bits (156), Expect = 5.5e-10 Identity = 35/53 (66.04%), Postives = 42/53 (79.25%), Query Frame = 0
BLAST of Carg26711 vs. Swiss-Prot
Match: sp|Q38847|AGL15_ARATH (Agamous-like MADS-box protein AGL15 OS=Arabidopsis thaliana OX=3702 GN=AGL15 PE=1 SV=1) HSP 1 Score: 63.5 bits (153), Expect = 1.2e-09 Identity = 34/53 (64.15%), Postives = 42/53 (79.25%), Query Frame = 0
BLAST of Carg26711 vs. Swiss-Prot
Match: sp|O80807|AGL23_ARATH (Agamous-like MADS-box protein AGL23 OS=Arabidopsis thaliana OX=3702 GN=AGL23 PE=2 SV=1) HSP 1 Score: 63.2 bits (152), Expect = 1.6e-09 Identity = 33/55 (60.00%), Postives = 42/55 (76.36%), Query Frame = 0
BLAST of Carg26711 vs. TrEMBL
Match: tr|A0A1S3CRI8|A0A1S3CRI8_CUCME (agamous-like MADS-box protein AGL62 OS=Cucumis melo OX=3656 GN=LOC103503920 PE=4 SV=1) HSP 1 Score: 122.5 bits (306), Expect = 4.5e-25 Identity = 70/107 (65.42%), Postives = 74/107 (69.16%), Query Frame = 0
BLAST of Carg26711 vs. TrEMBL
Match: tr|A0A0A0LE01|A0A0A0LE01_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_3G860240 PE=4 SV=1) HSP 1 Score: 122.1 bits (305), Expect = 5.9e-25 Identity = 70/107 (65.42%), Postives = 74/107 (69.16%), Query Frame = 0
BLAST of Carg26711 vs. TrEMBL
Match: tr|A0A1S3CAA4|A0A1S3CAA4_CUCME (agamous-like MADS-box protein AGL62 OS=Cucumis melo OX=3656 GN=LOC103498214 PE=4 SV=1) HSP 1 Score: 88.2 bits (217), Expect = 9.4e-15 Identity = 51/108 (47.22%), Postives = 67/108 (62.04%), Query Frame = 0
BLAST of Carg26711 vs. TrEMBL
Match: tr|A0A2P5AYS3|A0A2P5AYS3_PARAD (MADS-box transcription factor OS=Parasponia andersonii OX=3476 GN=PanMADS17b PE=4 SV=1) HSP 1 Score: 84.7 bits (208), Expect = 1.0e-13 Identity = 43/55 (78.18%), Postives = 50/55 (90.91%), Query Frame = 0
BLAST of Carg26711 vs. TrEMBL
Match: tr|A0A2P5CGN5|A0A2P5CGN5_9ROSA (MADS-box transcription factor OS=Trema orientalis OX=63057 GN=TorMADS17 PE=4 SV=1) HSP 1 Score: 84.7 bits (208), Expect = 1.0e-13 Identity = 43/55 (78.18%), Postives = 50/55 (90.91%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of silver-seed gourd
Date Performed: 2019-03-07
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|