Carg25236 (gene) Silver-seed gourd
The following sequences are available for this feature:
Legend: polypeptideexonCDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGAACCGATCAGCGCGGAGCCAAAACAGGTAACGACGAATTGCAACTCGCCGACCTCGAAATCCGCGCAGCCGGAGTTGGAATTAGACGATCAGAAGAAGAACGCGCAGATGACGAGGTCGCCGAGCGCTAGATCGACCTGCCTCTGCTCTCCGACGACGCACGTTGGATCTTTCCGGTGCCGGCTTCACCGAGGCACTGCCATCTCCCGCGGCGGCTCCGAGGGATCTAACCTCTCCGATCTGGCTCAGAAATCGGCGGCGGTGGAGGATTCAATGGAAGGTGAGTAG ATGGAACCGATCAGCGCGGAGCCAAAACAGGTAACGACGAATTGCAACTCGCCGACCTCGAAATCCGCGCAGCCGGAGTTGGAATTAGACGATCAGAAGAAGAACGCGCAGATGACGAGGTCGCCGAGCGCTAGATCGACCTGCCTCTGCTCTCCGACGACGCACGTTGGATCTTTCCGGTGCCGGCTTCACCGAGGCACTGCCATCTCCCGCGGCGGCTCCGAGGGATCTAACCTCTCCGATCTGGCTCAGAAATCGGCGGCGGTGGAGGATTCAATGGAAGGTGAGTAG ATGGAACCGATCAGCGCGGAGCCAAAACAGGTAACGACGAATTGCAACTCGCCGACCTCGAAATCCGCGCAGCCGGAGTTGGAATTAGACGATCAGAAGAAGAACGCGCAGATGACGAGGTCGCCGAGCGCTAGATCGACCTGCCTCTGCTCTCCGACGACGCACGTTGGATCTTTCCGGTGCCGGCTTCACCGAGGCACTGCCATCTCCCGCGGCGGCTCCGAGGGATCTAACCTCTCCGATCTGGCTCAGAAATCGGCGGCGGTGGAGGATTCAATGGAAGGTGAGTAG MEPISAEPKQVTTNCNSPTSKSAQPELELDDQKKNAQMTRSPSARSTCLCSPTTHVGSFRCRLHRGTAISRGGSEGSNLSDLAQKSAAVEDSMEGE
BLAST of Carg25236 vs. NCBI nr
Match: XP_022143490.1 (uncharacterized protein LOC111013367 [Momordica charantia]) HSP 1 Score: 125.9 bits (315), Expect = 7.2e-26 Identity = 66/105 (62.86%), Postives = 81/105 (77.14%), Query Frame = 0
BLAST of Carg25236 vs. NCBI nr
Match: KGN55991.1 (hypothetical protein Csa_3G045050 [Cucumis sativus]) HSP 1 Score: 120.2 bits (300), Expect = 3.9e-24 Identity = 64/101 (63.37%), Postives = 73/101 (72.28%), Query Frame = 0
BLAST of Carg25236 vs. NCBI nr
Match: XP_010064975.1 (PREDICTED: uncharacterized protein LOC104452162 [Eucalyptus grandis]) HSP 1 Score: 85.1 bits (209), Expect = 1.4e-13 Identity = 46/87 (52.87%), Postives = 60/87 (68.97%), Query Frame = 0
BLAST of Carg25236 vs. NCBI nr
Match: PON86349.1 (hypothetical protein TorRG33x02_179150 [Trema orientalis]) HSP 1 Score: 79.0 bits (193), Expect = 1.0e-11 Identity = 47/106 (44.34%), Postives = 66/106 (62.26%), Query Frame = 0
BLAST of Carg25236 vs. NCBI nr
Match: PON32972.1 (hypothetical protein PanWU01x14_356530 [Parasponia andersonii]) HSP 1 Score: 77.0 bits (188), Expect = 3.8e-11 Identity = 41/85 (48.24%), Postives = 55/85 (64.71%), Query Frame = 0
BLAST of Carg25236 vs. TAIR10
Match: AT5G55980.1 (serine-rich protein-related) HSP 1 Score: 59.3 bits (142), Expect = 1.5e-09 Identity = 36/83 (43.37%), Postives = 50/83 (60.24%), Query Frame = 0
BLAST of Carg25236 vs. TAIR10
Match: AT3G13227.1 (serine-rich protein-related) HSP 1 Score: 53.9 bits (128), Expect = 6.3e-08 Identity = 29/48 (60.42%), Postives = 33/48 (68.75%), Query Frame = 0
BLAST of Carg25236 vs. TAIR10
Match: AT1G67910.1 (unknown protein) HSP 1 Score: 46.2 bits (108), Expect = 1.3e-05 Identity = 23/44 (52.27%), Postives = 30/44 (68.18%), Query Frame = 0
BLAST of Carg25236 vs. TAIR10
Match: AT3G56500.1 (serine-rich protein-related) HSP 1 Score: 44.3 bits (103), Expect = 5.0e-05 Identity = 17/30 (56.67%), Postives = 23/30 (76.67%), Query Frame = 0
BLAST of Carg25236 vs. TAIR10
Match: AT1G24577.1 (unknown protein) HSP 1 Score: 43.5 bits (101), Expect = 8.5e-05 Identity = 17/35 (48.57%), Postives = 26/35 (74.29%), Query Frame = 0
BLAST of Carg25236 vs. TrEMBL
Match: tr|A0A0A0L7C7|A0A0A0L7C7_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_3G045050 PE=4 SV=1) HSP 1 Score: 120.2 bits (300), Expect = 2.6e-24 Identity = 64/101 (63.37%), Postives = 73/101 (72.28%), Query Frame = 0
BLAST of Carg25236 vs. TrEMBL
Match: tr|A0A2P5ELH4|A0A2P5ELH4_9ROSA (Uncharacterized protein OS=Trema orientalis OX=63057 GN=TorRG33x02_179150 PE=4 SV=1) HSP 1 Score: 79.0 bits (193), Expect = 6.7e-12 Identity = 47/106 (44.34%), Postives = 66/106 (62.26%), Query Frame = 0
BLAST of Carg25236 vs. TrEMBL
Match: tr|A0A2P5A8U7|A0A2P5A8U7_PARAD (Uncharacterized protein OS=Parasponia andersonii OX=3476 GN=PanWU01x14_356530 PE=4 SV=1) HSP 1 Score: 77.0 bits (188), Expect = 2.5e-11 Identity = 41/85 (48.24%), Postives = 55/85 (64.71%), Query Frame = 0
BLAST of Carg25236 vs. TrEMBL
Match: tr|W9SBP1|W9SBP1_9ROSA (Uncharacterized protein OS=Morus notabilis OX=981085 GN=L484_020205 PE=4 SV=1) HSP 1 Score: 75.9 bits (185), Expect = 5.6e-11 Identity = 42/91 (46.15%), Postives = 56/91 (61.54%), Query Frame = 0
BLAST of Carg25236 vs. TrEMBL
Match: tr|A0A2K3P5S5|A0A2K3P5S5_TRIPR (Uncharacterized protein OS=Trifolium pratense OX=57577 GN=L195_g007213 PE=4 SV=1) HSP 1 Score: 74.7 bits (182), Expect = 1.3e-10 Identity = 37/62 (59.68%), Postives = 47/62 (75.81%), Query Frame = 0
The following BLAST results are available for this feature:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of silver-seed gourd
Date Performed: 2019-03-07
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene: None |