Carg19689 (gene) Silver-seed gourd
The following sequences are available for this feature:
Legend: polypeptideCDSexon Hold the cursor over a type above to highlight its positions in the sequence below.ATGGCTACCAAAAGGGATGAGATGAAGAGAGGTGGTGGTGGGAACTACAGGGGAAGAGACAGGTTTAGTGAGAGGAAAGGATATCGAGCTGGTGGTAGTACCCGTGTGGAGAAACGGAAGCACGACCTATTTCACGAGGCTAATCGGAGTCCAACCCCGAAGAATGAAGAGGACCAAATTTCCAAGGTTGAAGCTCTTCTTGCTTCCTAG ATGGCTACCAAAAGGGATGAGATGAAGAGAGGTGGTGGTGGGAACTACAGGGGAAGAGACAGGTTTAGTGAGAGGAAAGGATATCGAGCTGGTGGTAGTACCCGTGTGGAGAAACGGAAGCACGACCTATTTCACGAGGCTAATCGGAGTCCAACCCCGAAGAATGAAGAGGACCAAATTTCCAAGGTTGAAGCTCTTCTTGCTTCCTAG ATGGCTACCAAAAGGGATGAGATGAAGAGAGGTGGTGGTGGGAACTACAGGGGAAGAGACAGGTTTAGTGAGAGGAAAGGATATCGAGCTGGTGGTAGTACCCGTGTGGAGAAACGGAAGCACGACCTATTTCACGAGGCTAATCGGAGTCCAACCCCGAAGAATGAAGAGGACCAAATTTCCAAGGTTGAAGCTCTTCTTGCTTCCTAG MATKRDEMKRGGGGNYRGRDRFSERKGYRAGGSTRVEKRKHDLFHEANRSPTPKNEEDQISKVEALLAS
BLAST of Carg19689 vs. NCBI nr
Match: XP_022942672.1 (pre-mRNA-splicing factor CWC25-like isoform X2 [Cucurbita moschata]) HSP 1 Score: 116.7 bits (291), Expect = 3.1e-23 Identity = 60/69 (86.96%), Postives = 63/69 (91.30%), Query Frame = 0
BLAST of Carg19689 vs. NCBI nr
Match: XP_022984554.1 (pre-mRNA-splicing factor CWC25 isoform X2 [Cucurbita maxima]) HSP 1 Score: 113.6 bits (283), Expect = 2.6e-22 Identity = 59/69 (85.51%), Postives = 62/69 (89.86%), Query Frame = 0
BLAST of Carg19689 vs. NCBI nr
Match: XP_022942670.1 (pre-mRNA-splicing factor CWC25-like isoform X1 [Cucurbita moschata] >XP_022942671.1 pre-mRNA-splicing factor CWC25-like isoform X1 [Cucurbita moschata]) HSP 1 Score: 107.8 bits (268), Expect = 1.5e-20 Identity = 60/81 (74.07%), Postives = 63/81 (77.78%), Query Frame = 0
BLAST of Carg19689 vs. NCBI nr
Match: XP_023521659.1 (pre-mRNA-splicing factor CWC25-like [Cucurbita pepo subsp. pepo]) HSP 1 Score: 107.8 bits (268), Expect = 1.5e-20 Identity = 60/81 (74.07%), Postives = 63/81 (77.78%), Query Frame = 0
BLAST of Carg19689 vs. NCBI nr
Match: XP_023548006.1 (pre-mRNA-splicing factor CWC25-like [Cucurbita pepo subsp. pepo] >XP_023548014.1 pre-mRNA-splicing factor CWC25-like [Cucurbita pepo subsp. pepo]) HSP 1 Score: 107.8 bits (268), Expect = 1.5e-20 Identity = 60/81 (74.07%), Postives = 63/81 (77.78%), Query Frame = 0
BLAST of Carg19689 vs. TAIR10
Match: AT3G19650.1 (cyclin-related) HSP 1 Score: 46.6 bits (109), Expect = 7.2e-06 Identity = 36/68 (52.94%), Postives = 45/68 (66.18%), Query Frame = 0
BLAST of Carg19689 vs. TrEMBL
Match: tr|A0A1S3BY17|A0A1S3BY17_CUCME (uncharacterized protein LOC103494816 OS=Cucumis melo OX=3656 GN=LOC103494816 PE=4 SV=1) HSP 1 Score: 100.9 bits (250), Expect = 1.2e-18 Identity = 58/81 (71.60%), Postives = 62/81 (76.54%), Query Frame = 0
BLAST of Carg19689 vs. TrEMBL
Match: tr|A0A0A0KV12|A0A0A0KV12_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_4G000750 PE=4 SV=1) HSP 1 Score: 100.9 bits (250), Expect = 1.2e-18 Identity = 58/81 (71.60%), Postives = 62/81 (76.54%), Query Frame = 0
BLAST of Carg19689 vs. TrEMBL
Match: tr|A0A2P6PLG6|A0A2P6PLG6_ROSCH (Uncharacterized protein OS=Rosa chinensis OX=74649 GN=RchiOBHm_Chr6g0253781 PE=4 SV=1) HSP 1 Score: 84.3 bits (207), Expect = 1.1e-13 Identity = 48/66 (72.73%), Postives = 53/66 (80.30%), Query Frame = 0
BLAST of Carg19689 vs. TrEMBL
Match: tr|A0A2R6R1Z3|A0A2R6R1Z3_ACTCH (Pre-mRNA-splicing factor like OS=Actinidia chinensis var. chinensis OX=1590841 GN=CEY00_Acc11298 PE=4 SV=1) HSP 1 Score: 83.2 bits (204), Expect = 2.5e-13 Identity = 42/55 (76.36%), Postives = 46/55 (83.64%), Query Frame = 0
BLAST of Carg19689 vs. TrEMBL
Match: tr|W9SX05|W9SX05_9ROSA (Uncharacterized protein OS=Morus notabilis OX=981085 GN=L484_003671 PE=4 SV=1) HSP 1 Score: 82.8 bits (203), Expect = 3.3e-13 Identity = 47/69 (68.12%), Postives = 54/69 (78.26%), Query Frame = 0
The following BLAST results are available for this feature:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of silver-seed gourd
Date Performed: 2019-03-07
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene:
The following block(s) are covering this gene:
|