Carg15443 (gene) Silver-seed gourd
The following sequences are available for this feature:
Legend: polypeptideCDSexon Hold the cursor over a type above to highlight its positions in the sequence below.ATGGTAATTTTCCTTTCTTCTTTAATCCATTCTTCTTCCTTACCTTCGATTATTTTCTCCTCTAGGGTTTTGTGTTGCAGATTTGATCTGTGGTTTGATTTTTGGATTTTGTTTCCGGATTTGATGTGATTTTCGTTTTCGATTTATGATTTTGATTTTATGGAAATTTCAGACGACATCACGGCGTTTTGCGGATAGGAAGGTTGAGAGGTTCGAGAAGAACATTTTGAAGAGAGGGGCCGTGCCCGAGACTGCTACGAAGAAGGGAAAGGACTACCCCGTTGGGCCTCTTCTTCTTGGATTCTTCGTTTTTGTCGTCATTGGATCATGTGAGTTTTTCCTTGCTCGCTCTTCGAGATTCTGA ATGACGACATCACGGCGTTTTGCGGATAGGAAGGTTGAGAGGTTCGAGAAGAACATTTTGAAGAGAGGGGCCGTGCCCGAGACTGCTACGAAGAAGGGAAAGGACTACCCCGTTGGGCCTCTTCTTCTTGGATTCTTCGTTTTTGTCGTCATTGGATCATGTGAGTTTTTCCTTGCTCGCTCTTCGAGATTCTGA ATGACGACATCACGGCGTTTTGCGGATAGGAAGGTTGAGAGGTTCGAGAAGAACATTTTGAAGAGAGGGGCCGTGCCCGAGACTGCTACGAAGAAGGGAAAGGACTACCCCGTTGGGCCTCTTCTTCTTGGATTCTTCGTTTTTGTCGTCATTGGATCATGTGAGTTTTTCCTTGCTCGCTCTTCGAGATTCTGA MTTSRRFADRKVERFEKNILKRGAVPETATKKGKDYPVGPLLLGFFVFVVIGSCEFFLARSSRF
BLAST of Carg15443 vs. NCBI nr
Match: XP_022932563.1 (stress-associated endoplasmic reticulum protein 2-like isoform X2 [Cucurbita moschata] >XP_022972333.1 stress-associated endoplasmic reticulum protein 2-like [Cucurbita maxima] >XP_023538872.1 stress-associated endoplasmic reticulum protein 2-like [Cucurbita pepo subsp. pepo]) HSP 1 Score: 110.9 bits (276), Expect = 1.6e-21 Identity = 55/62 (88.71%), Postives = 58/62 (93.55%), Query Frame = 0
BLAST of Carg15443 vs. NCBI nr
Match: XP_022932562.1 (stress-associated endoplasmic reticulum protein 2-like isoform X1 [Cucurbita moschata]) HSP 1 Score: 109.0 bits (271), Expect = 6.0e-21 Identity = 54/61 (88.52%), Postives = 57/61 (93.44%), Query Frame = 0
BLAST of Carg15443 vs. NCBI nr
Match: XP_004152134.1 (PREDICTED: stress-associated endoplasmic reticulum protein 2-like [Cucumis sativus] >KGN53016.1 Stress associated endoplasmic reticulum protein [Cucumis sativus]) HSP 1 Score: 107.8 bits (268), Expect = 1.3e-20 Identity = 53/62 (85.48%), Postives = 57/62 (91.94%), Query Frame = 0
BLAST of Carg15443 vs. NCBI nr
Match: XP_022956326.1 (stress-associated endoplasmic reticulum protein 2-like [Cucurbita moschata] >XP_022979456.1 stress-associated endoplasmic reticulum protein 2-like [Cucurbita maxima] >XP_023526291.1 stress-associated endoplasmic reticulum protein 2-like [Cucurbita pepo subsp. pepo]) HSP 1 Score: 107.1 bits (266), Expect = 2.3e-20 Identity = 53/62 (85.48%), Postives = 56/62 (90.32%), Query Frame = 0
BLAST of Carg15443 vs. NCBI nr
Match: XP_022158961.1 (stress-associated endoplasmic reticulum protein 2-like [Momordica charantia]) HSP 1 Score: 106.7 bits (265), Expect = 3.0e-20 Identity = 52/62 (83.87%), Postives = 57/62 (91.94%), Query Frame = 0
BLAST of Carg15443 vs. TAIR10
Match: AT1G27350.1 (Ribosome associated membrane protein RAMP4) HSP 1 Score: 100.1 bits (248), Expect = 5.1e-22 Identity = 47/62 (75.81%), Postives = 55/62 (88.71%), Query Frame = 0
BLAST of Carg15443 vs. TAIR10
Match: AT1G27330.1 (Ribosome associated membrane protein RAMP4) HSP 1 Score: 100.1 bits (248), Expect = 5.1e-22 Identity = 47/62 (75.81%), Postives = 55/62 (88.71%), Query Frame = 0
BLAST of Carg15443 vs. Swiss-Prot
Match: sp|Q3T073|SERP2_BOVIN (Stress-associated endoplasmic reticulum protein 2 OS=Bos taurus OX=9913 GN=SERP2 PE=3 SV=1) HSP 1 Score: 49.3 bits (116), Expect = 1.9e-05 Identity = 25/51 (49.02%), Postives = 32/51 (62.75%), Query Frame = 0
BLAST of Carg15443 vs. Swiss-Prot
Match: sp|Q8N6R1|SERP2_HUMAN (Stress-associated endoplasmic reticulum protein 2 OS=Homo sapiens OX=9606 GN=SERP2 PE=1 SV=1) HSP 1 Score: 49.3 bits (116), Expect = 1.9e-05 Identity = 25/51 (49.02%), Postives = 32/51 (62.75%), Query Frame = 0
BLAST of Carg15443 vs. Swiss-Prot
Match: sp|Q6TAW2|SERP2_MOUSE (Stress-associated endoplasmic reticulum protein 2 OS=Mus musculus OX=10090 GN=Serp2 PE=3 SV=2) HSP 1 Score: 49.3 bits (116), Expect = 1.9e-05 Identity = 25/51 (49.02%), Postives = 32/51 (62.75%), Query Frame = 0
BLAST of Carg15443 vs. TrEMBL
Match: tr|A0A0A0KYW0|A0A0A0KYW0_CUCSA (Stress associated endoplasmic reticulum protein OS=Cucumis sativus OX=3659 GN=Csa_4G011630 PE=4 SV=1) HSP 1 Score: 107.8 bits (268), Expect = 8.9e-21 Identity = 53/62 (85.48%), Postives = 57/62 (91.94%), Query Frame = 0
BLAST of Carg15443 vs. TrEMBL
Match: tr|A0A2I4FYQ4|A0A2I4FYQ4_9ROSI (stress-associated endoplasmic reticulum protein 2-like OS=Juglans regia OX=51240 GN=LOC109003195 PE=4 SV=1) HSP 1 Score: 105.5 bits (262), Expect = 4.4e-20 Identity = 51/62 (82.26%), Postives = 56/62 (90.32%), Query Frame = 0
BLAST of Carg15443 vs. TrEMBL
Match: tr|A0A059D975|A0A059D975_EUCGR (Uncharacterized protein (Fragment) OS=Eucalyptus grandis OX=71139 GN=EUGRSUZ_B03504 PE=4 SV=1) HSP 1 Score: 103.6 bits (257), Expect = 1.7e-19 Identity = 50/62 (80.65%), Postives = 55/62 (88.71%), Query Frame = 0
BLAST of Carg15443 vs. TrEMBL
Match: tr|A0A059B8I0|A0A059B8I0_EUCGR (Uncharacterized protein OS=Eucalyptus grandis OX=71139 GN=EUGRSUZ_H04633 PE=4 SV=1) HSP 1 Score: 103.6 bits (257), Expect = 1.7e-19 Identity = 50/62 (80.65%), Postives = 55/62 (88.71%), Query Frame = 0
BLAST of Carg15443 vs. TrEMBL
Match: tr|A0A0L9TM23|A0A0L9TM23_PHAAN (Uncharacterized protein (Fragment) OS=Phaseolus angularis OX=3914 GN=LR48_Vigan01g106100 PE=4 SV=1) HSP 1 Score: 103.6 bits (257), Expect = 1.7e-19 Identity = 49/61 (80.33%), Postives = 55/61 (90.16%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of silver-seed gourd
Date Performed: 2019-03-07
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene:
The following block(s) are covering this gene:
|