Carg12399 (gene) Silver-seed gourd
The following sequences are available for this feature:
Legend: polypeptideexonCDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGAATTCCACATGACATTTTTCTGGGGAAAGTCGGCGGAGATTCTGTTCGCCGGCTGGCCTGGCCGGAGCTCACTCTCTTACGCCATCGCCTTAGTCTTCGTCTTTCTCGTAGCCTTCGCCGTGGAGTGGCTGTCGCACACTAAACTCACCGCCTCTGTCGCCGATGACGTCTTCGCCGGCTTTGTTCAGACCGCCCTGTACGGCGTCCGGGTGGGGTTGGCTTTTGTCGTCATGCTGGCCGTCATGTCATTCAATGTCGGAGTCCTGCTTGCGGCGGTGGCCGGGTATTCGGTCGGGTTCTTGGTTTATGGGAGCCGGGTTTTTAATAGATCCAAAATTGACCTAAATTTGAATATGTCTGATATACCACCGCTTAATTGTTAA ATGGAATTCCACATGACATTTTTCTGGGGAAAGTCGGCGGAGATTCTGTTCGCCGGCTGGCCTGGCCGGAGCTCACTCTCTTACGCCATCGCCTTAGTCTTCGTCTTTCTCGTAGCCTTCGCCGTGGAGTGGCTGTCGCACACTAAACTCACCGCCTCTGTCGCCGATGACGTCTTCGCCGGCTTTGTTCAGACCGCCCTGTACGGCGTCCGGGTGGGGTTGGCTTTTGTCGTCATGCTGGCCGTCATGTCATTCAATGTCGGAGTCCTGCTTGCGGCGGTGGCCGGGTATTCGGTCGGGTTCTTGGTTTATGGGAGCCGGGTTTTTAATAGATCCAAAATTGACCTAAATTTGAATATGTCTGATATACCACCGCTTAATTGTTAA ATGGAATTCCACATGACATTTTTCTGGGGAAAGTCGGCGGAGATTCTGTTCGCCGGCTGGCCTGGCCGGAGCTCACTCTCTTACGCCATCGCCTTAGTCTTCGTCTTTCTCGTAGCCTTCGCCGTGGAGTGGCTGTCGCACACTAAACTCACCGCCTCTGTCGCCGATGACGTCTTCGCCGGCTTTGTTCAGACCGCCCTGTACGGCGTCCGGGTGGGGTTGGCTTTTGTCGTCATGCTGGCCGTCATGTCATTCAATGTCGGAGTCCTGCTTGCGGCGGTGGCCGGGTATTCGGTCGGGTTCTTGGTTTATGGGAGCCGGGTTTTTAATAGATCCAAAATTGACCTAAATTTGAATATGTCTGATATACCACCGCTTAATTGTTAA MEFHMTFFWGKSAEILFAGWPGRSSLSYAIALVFVFLVAFAVEWLSHTKLTASVADDVFAGFVQTALYGVRVGLAFVVMLAVMSFNVGVLLAAVAGYSVGFLVYGSRVFNRSKIDLNLNMSDIPPLNC
BLAST of Carg12399 vs. NCBI nr
Match: XP_023525766.1 (copper transporter 1-like [Cucurbita pepo subsp. pepo]) HSP 1 Score: 247.7 bits (631), Expect = 2.2e-62 Identity = 128/128 (100.00%), Postives = 128/128 (100.00%), Query Frame = 0
BLAST of Carg12399 vs. NCBI nr
Match: XP_022998910.1 (copper transporter 1-like [Cucurbita maxima]) HSP 1 Score: 247.3 bits (630), Expect = 2.8e-62 Identity = 127/128 (99.22%), Postives = 128/128 (100.00%), Query Frame = 0
BLAST of Carg12399 vs. NCBI nr
Match: XP_022948639.1 (copper transporter 1-like [Cucurbita moschata]) HSP 1 Score: 246.5 bits (628), Expect = 4.9e-62 Identity = 127/128 (99.22%), Postives = 128/128 (100.00%), Query Frame = 0
BLAST of Carg12399 vs. NCBI nr
Match: XP_009785614.1 (PREDICTED: copper transporter 6-like [Nicotiana sylvestris] >XP_016481424.1 PREDICTED: copper transporter 6-like [Nicotiana tabacum]) HSP 1 Score: 158.7 bits (400), Expect = 1.3e-35 Identity = 76/129 (58.91%), Postives = 101/129 (78.29%), Query Frame = 0
BLAST of Carg12399 vs. NCBI nr
Match: KGN65764.1 (hypothetical protein Csa_1G526835 [Cucumis sativus]) HSP 1 Score: 158.3 bits (399), Expect = 1.7e-35 Identity = 81/130 (62.31%), Postives = 94/130 (72.31%), Query Frame = 0
BLAST of Carg12399 vs. TAIR10
Match: AT5G59030.1 (copper transporter 1) HSP 1 Score: 122.5 bits (306), Expect = 1.9e-28 Identity = 62/124 (50.00%), Postives = 85/124 (68.55%), Query Frame = 0
BLAST of Carg12399 vs. TAIR10
Match: AT3G46900.1 (copper transporter 2) HSP 1 Score: 120.6 bits (301), Expect = 7.3e-28 Identity = 59/113 (52.21%), Postives = 81/113 (71.68%), Query Frame = 0
BLAST of Carg12399 vs. TAIR10
Match: AT2G26975.1 (Ctr copper transporter family) HSP 1 Score: 116.3 bits (290), Expect = 1.4e-26 Identity = 59/113 (52.21%), Postives = 79/113 (69.91%), Query Frame = 0
BLAST of Carg12399 vs. TAIR10
Match: AT5G59040.1 (copper transporter 3) HSP 1 Score: 102.4 bits (254), Expect = 2.1e-22 Identity = 52/106 (49.06%), Postives = 72/106 (67.92%), Query Frame = 0
BLAST of Carg12399 vs. TAIR10
Match: AT2G37925.1 (copper transporter 4) HSP 1 Score: 97.1 bits (240), Expect = 8.6e-21 Identity = 50/114 (43.86%), Postives = 75/114 (65.79%), Query Frame = 0
BLAST of Carg12399 vs. Swiss-Prot
Match: sp|Q39065|COPT1_ARATH (Copper transporter 1 OS=Arabidopsis thaliana OX=3702 GN=COPT1 PE=2 SV=2) HSP 1 Score: 122.5 bits (306), Expect = 3.5e-27 Identity = 62/124 (50.00%), Postives = 85/124 (68.55%), Query Frame = 0
BLAST of Carg12399 vs. Swiss-Prot
Match: sp|Q9STG2|COPT2_ARATH (Copper transporter 2 OS=Arabidopsis thaliana OX=3702 GN=COPT2 PE=2 SV=1) HSP 1 Score: 120.6 bits (301), Expect = 1.3e-26 Identity = 59/113 (52.21%), Postives = 81/113 (71.68%), Query Frame = 0
BLAST of Carg12399 vs. Swiss-Prot
Match: sp|Q8GWP3|COPT6_ARATH (Copper transporter 6 OS=Arabidopsis thaliana OX=3702 GN=COPT6 PE=2 SV=1) HSP 1 Score: 116.3 bits (290), Expect = 2.5e-25 Identity = 59/113 (52.21%), Postives = 79/113 (69.91%), Query Frame = 0
BLAST of Carg12399 vs. Swiss-Prot
Match: sp|Q9FGU8|COPT3_ARATH (Copper transporter 3 OS=Arabidopsis thaliana OX=3702 GN=COPT3 PE=2 SV=1) HSP 1 Score: 102.4 bits (254), Expect = 3.7e-21 Identity = 52/106 (49.06%), Postives = 72/106 (67.92%), Query Frame = 0
BLAST of Carg12399 vs. Swiss-Prot
Match: sp|Q8SAA5|COPT4_ARATH (Copper transporter 4 OS=Arabidopsis thaliana OX=3702 GN=COPT4 PE=2 SV=2) HSP 1 Score: 97.1 bits (240), Expect = 1.6e-19 Identity = 50/114 (43.86%), Postives = 75/114 (65.79%), Query Frame = 0
BLAST of Carg12399 vs. TrEMBL
Match: tr|A0A1S4AXZ3|A0A1S4AXZ3_TOBAC (copper transporter 6-like OS=Nicotiana tabacum OX=4097 GN=LOC107802430 PE=4 SV=1) HSP 1 Score: 158.7 bits (400), Expect = 8.8e-36 Identity = 76/129 (58.91%), Postives = 101/129 (78.29%), Query Frame = 0
BLAST of Carg12399 vs. TrEMBL
Match: tr|A0A1U7XF90|A0A1U7XF90_NICSY (copper transporter 6-like OS=Nicotiana sylvestris OX=4096 GN=LOC104233862 PE=4 SV=1) HSP 1 Score: 158.7 bits (400), Expect = 8.8e-36 Identity = 76/129 (58.91%), Postives = 101/129 (78.29%), Query Frame = 0
BLAST of Carg12399 vs. TrEMBL
Match: tr|A0A0A0LXH5|A0A0A0LXH5_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_1G526835 PE=4 SV=1) HSP 1 Score: 158.3 bits (399), Expect = 1.2e-35 Identity = 81/130 (62.31%), Postives = 94/130 (72.31%), Query Frame = 0
BLAST of Carg12399 vs. TrEMBL
Match: tr|V4SMC6|V4SMC6_9ROSI (Uncharacterized protein OS=Citrus clementina OX=85681 GN=CICLE_v10029961mg PE=4 SV=1) HSP 1 Score: 156.0 bits (393), Expect = 5.7e-35 Identity = 76/126 (60.32%), Postives = 99/126 (78.57%), Query Frame = 0
BLAST of Carg12399 vs. TrEMBL
Match: tr|A0A067FKS2|A0A067FKS2_CITSI (Uncharacterized protein OS=Citrus sinensis OX=2711 GN=CISIN_1g033054mg PE=4 SV=1) HSP 1 Score: 156.0 bits (393), Expect = 5.7e-35 Identity = 76/126 (60.32%), Postives = 99/126 (78.57%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of silver-seed gourd
Date Performed: 2019-03-07
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene: |