Carg12204 (gene) Silver-seed gourd
The following sequences are available for this feature:
Legend: exonfive_prime_UTRpolypeptideCDSthree_prime_UTR Hold the cursor over a type above to highlight its positions in the sequence below.TATATACACGCTAGTATTATATAATAAATTCCATTATAATCCTCTCTTTGCCTCTTCCTGTGTCGTTCTGATAATATAGAAGATCATGTTGGAAGGGAAAGCCACCGTCAAACAAACCGACATGTCGGAGAAGATGCAGATTCACGCCAAGGCCTCTGCATCTCACGCCCTCGATCTCTTCGACGTCTCCGATTGCCTCTCGCTTGCTGCACATATCAAGAAGGTATAATTTCCTTTTCCTTTTCATTTTAATTTTAATTTTAATTTGGTATGATATTATCAAAATTAAATCAATTAGGAATTTGATCGGAGCTATGGGAGTGGGTGGCAATGTGTGGTGGGTTCCAATTTCGGCTGCTTCTTCACTCATTCAAAGGGGACCTTCATCTATTTTTCCCTTGAAACTCTCAATTTTCTCATCTTTAAAGCTGCTTCCAACTAATTATTTCCAAAATTACCATTTCAAAGCACCACAAATGCTTCCATCTTCAGGGGCACCCTCGTCCTTTCCCCTCCTCCTCTCTCTAAATTACATGGAACCAACCATG TATATACACGCTAGTATTATATAATAAATTCCATTATAATCCTCTCTTTGCCTCTTCCTGTGTCGTTCTGATAATATAGAAGATCATGTTGGAAGGGAAAGCCACCGTCAAACAAACCGACATGTCGGAGAAGATGCAGATTCACGCCAAGGCCTCTGCATCTCACGCCCTCGATCTCTTCGACGTCTCCGATTGCCTCTCGCTTGCTGCACATATCAAGAAGGAATTTGATCGGAGCTATGGGAGTGGGTGGCAATGTGTGGTGGGTTCCAATTTCGGCTGCTTCTTCACTCATTCAAAGGGGACCTTCATCTATTTTTCCCTTGAAACTCTCAATTTTCTCATCTTTAAAGCTGCTTCCAACTAATTATTTCCAAAATTACCATTTCAAAGCACCACAAATGCTTCCATCTTCAGGGGCACCCTCGTCCTTTCCCCTCCTCCTCTCTCTAAATTACATGGAACCAACCATG ATGTTGGAAGGGAAAGCCACCGTCAAACAAACCGACATGTCGGAGAAGATGCAGATTCACGCCAAGGCCTCTGCATCTCACGCCCTCGATCTCTTCGACGTCTCCGATTGCCTCTCGCTTGCTGCACATATCAAGAAGGAATTTGATCGGAGCTATGGGAGTGGGTGGCAATGTGTGGTGGGTTCCAATTTCGGCTGCTTCTTCACTCATTCAAAGGGGACCTTCATCTATTTTTCCCTTGAAACTCTCAATTTTCTCATCTTTAAAGCTGCTTCCAACTAA MLEGKATVKQTDMSEKMQIHAKASASHALDLFDVSDCLSLAAHIKKEFDRSYGSGWQCVVGSNFGCFFTHSKGTFIYFSLETLNFLIFKAASN
BLAST of Carg12204 vs. NCBI nr
Match: XP_022933771.1 (dynein light chain 1, cytoplasmic-like [Cucurbita moschata] >XP_022973196.1 dynein light chain 1, cytoplasmic-like [Cucurbita maxima] >XP_023529424.1 dynein light chain 1, cytoplasmic-like [Cucurbita pepo subsp. pepo]) HSP 1 Score: 188.7 bits (478), Expect = 8.7e-45 Identity = 93/93 (100.00%), Postives = 93/93 (100.00%), Query Frame = 0
BLAST of Carg12204 vs. NCBI nr
Match: XP_008462685.1 (PREDICTED: dynein light chain 1, cytoplasmic-like [Cucumis melo]) HSP 1 Score: 163.7 bits (413), Expect = 3.0e-37 Identity = 80/92 (86.96%), Postives = 87/92 (94.57%), Query Frame = 0
BLAST of Carg12204 vs. NCBI nr
Match: XP_004150050.1 (PREDICTED: dynein light chain 1, cytoplasmic-like [Cucumis sativus]) HSP 1 Score: 163.3 bits (412), Expect = 3.9e-37 Identity = 80/92 (86.96%), Postives = 86/92 (93.48%), Query Frame = 0
BLAST of Carg12204 vs. NCBI nr
Match: XP_014508216.1 (dynein light chain 1, cytoplasmic [Vigna radiata var. radiata]) HSP 1 Score: 161.8 bits (408), Expect = 1.1e-36 Identity = 76/93 (81.72%), Postives = 86/93 (92.47%), Query Frame = 0
BLAST of Carg12204 vs. NCBI nr
Match: XP_022144999.1 (dynein light chain 1, cytoplasmic-like [Momordica charantia]) HSP 1 Score: 161.8 bits (408), Expect = 1.1e-36 Identity = 79/89 (88.76%), Postives = 82/89 (92.13%), Query Frame = 0
BLAST of Carg12204 vs. TAIR10
Match: AT3G16120.1 (Dynein light chain type 1 family protein) HSP 1 Score: 141.7 bits (356), Expect = 2.2e-34 Identity = 69/92 (75.00%), Postives = 77/92 (83.70%), Query Frame = 0
BLAST of Carg12204 vs. TAIR10
Match: AT4G27360.1 (Dynein light chain type 1 family protein) HSP 1 Score: 104.4 bits (259), Expect = 3.9e-23 Identity = 51/91 (56.04%), Postives = 66/91 (72.53%), Query Frame = 0
BLAST of Carg12204 vs. TAIR10
Match: AT1G52240.1 (RHO guanyl-nucleotide exchange factor 11) HSP 1 Score: 86.7 bits (213), Expect = 8.5e-18 Identity = 42/59 (71.19%), Postives = 46/59 (77.97%), Query Frame = 0
BLAST of Carg12204 vs. TAIR10
Match: AT5G20110.1 (Dynein light chain type 1 family protein) HSP 1 Score: 77.0 bits (188), Expect = 6.7e-15 Identity = 38/78 (48.72%), Postives = 48/78 (61.54%), Query Frame = 0
BLAST of Carg12204 vs. TAIR10
Match: AT4G15930.1 (Dynein light chain type 1 family protein) HSP 1 Score: 68.2 bits (165), Expect = 3.1e-12 Identity = 34/86 (39.53%), Postives = 50/86 (58.14%), Query Frame = 0
BLAST of Carg12204 vs. Swiss-Prot
Match: sp|P61285|DYL1_BOVIN (Dynein light chain 1, cytoplasmic OS=Bos taurus OX=9913 GN=DYNLL1 PE=1 SV=1) HSP 1 Score: 79.7 bits (195), Expect = 1.9e-14 Identity = 40/90 (44.44%), Postives = 56/90 (62.22%), Query Frame = 0
BLAST of Carg12204 vs. Swiss-Prot
Match: sp|P63167|DYL1_HUMAN (Dynein light chain 1, cytoplasmic OS=Homo sapiens OX=9606 GN=DYNLL1 PE=1 SV=1) HSP 1 Score: 79.7 bits (195), Expect = 1.9e-14 Identity = 40/90 (44.44%), Postives = 56/90 (62.22%), Query Frame = 0
BLAST of Carg12204 vs. Swiss-Prot
Match: sp|P61273|DYL1_MACFA (Dynein light chain 1, cytoplasmic OS=Macaca fascicularis OX=9541 GN=DYNLL1 PE=3 SV=1) HSP 1 Score: 79.7 bits (195), Expect = 1.9e-14 Identity = 40/90 (44.44%), Postives = 56/90 (62.22%), Query Frame = 0
BLAST of Carg12204 vs. Swiss-Prot
Match: sp|P63168|DYL1_MOUSE (Dynein light chain 1, cytoplasmic OS=Mus musculus OX=10090 GN=Dynll1 PE=1 SV=1) HSP 1 Score: 79.7 bits (195), Expect = 1.9e-14 Identity = 40/90 (44.44%), Postives = 56/90 (62.22%), Query Frame = 0
BLAST of Carg12204 vs. Swiss-Prot
Match: sp|P63169|DYL1_RABIT (Dynein light chain 1, cytoplasmic OS=Oryctolagus cuniculus OX=9986 GN=DYNLL1 PE=1 SV=1) HSP 1 Score: 79.7 bits (195), Expect = 1.9e-14 Identity = 40/90 (44.44%), Postives = 56/90 (62.22%), Query Frame = 0
BLAST of Carg12204 vs. TrEMBL
Match: tr|A0A1S3CJ38|A0A1S3CJ38_CUCME (Dynein light chain OS=Cucumis melo OX=3656 GN=LOC103500988 PE=3 SV=1) HSP 1 Score: 163.7 bits (413), Expect = 2.0e-37 Identity = 80/92 (86.96%), Postives = 87/92 (94.57%), Query Frame = 0
BLAST of Carg12204 vs. TrEMBL
Match: tr|A0A1S3UQ79|A0A1S3UQ79_VIGRR (Dynein light chain OS=Vigna radiata var. radiata OX=3916 GN=LOC106767782 PE=3 SV=1) HSP 1 Score: 161.8 bits (408), Expect = 7.6e-37 Identity = 76/93 (81.72%), Postives = 86/93 (92.47%), Query Frame = 0
BLAST of Carg12204 vs. TrEMBL
Match: tr|A0A0L9VRV1|A0A0L9VRV1_PHAAN (Dynein light chain OS=Phaseolus angularis OX=3914 GN=LR48_Vigan11g083300 PE=3 SV=1) HSP 1 Score: 161.4 bits (407), Expect = 9.9e-37 Identity = 76/93 (81.72%), Postives = 85/93 (91.40%), Query Frame = 0
BLAST of Carg12204 vs. TrEMBL
Match: tr|A0A0S3QWU7|A0A0S3QWU7_PHAAN (Dynein light chain OS=Vigna angularis var. angularis OX=157739 GN=Vigan.01G026900 PE=3 SV=1) HSP 1 Score: 161.4 bits (407), Expect = 9.9e-37 Identity = 76/93 (81.72%), Postives = 85/93 (91.40%), Query Frame = 0
BLAST of Carg12204 vs. TrEMBL
Match: tr|V7CSS4|V7CSS4_PHAVU (Dynein light chain OS=Phaseolus vulgaris OX=3885 GN=PHAVU_002G312600g PE=3 SV=1) HSP 1 Score: 161.4 bits (407), Expect = 9.9e-37 Identity = 77/93 (82.80%), Postives = 84/93 (90.32%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of silver-seed gourd
Date Performed: 2019-03-07
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene:
The following block(s) are covering this gene: |