Carg07857 (gene) Silver-seed gourd
The following sequences are available for this feature:
Legend: polypeptideCDSexon Hold the cursor over a type above to highlight its positions in the sequence below.TTCCAGGTAACCGAAGAAGTTGAAGGGACACGGTTCAACACAGGAATCTCAGCTACGATGGAGTTCGTTAACATGGCATATAGGTGGACTTACATTAAAAGGTGAGGGGATTCGAACCTATAACCTCTTGGTCAATGGCATATGCGTTAATGATATGAACTATGCTTTGTTTGGCATATATCAAGAGATTAAAAAACTTGATATCTAGATCCAATTTTGACAGAAATGTTTATTTGGATATTAATGTTTAAGATTACATTATTTCTTTGCCATTTCACTTCTCTTCCTATCAGACTGATGCCATTTTTTAGCTAGGGACAGATATCCAAGGTCTATTGTTGAAGCATTCACTTTGTTGCTTTCACTGTACGCACCTCACTTGGCTGAGGAACTTTGTTCTTGGTTAGGACACTCAGAATTGTTGGCATACGAGTCCTTCCCCGAGGTGTGA TTCCAGGTAACCGAAGAAGTTGAAGGGACACGGTTCAACACAGGAATCTCAGCTACGATGGAGTTCGTTAACATGGCATATAGGTGGACTTACATTAAAAGGGACAGATATCCAAGGTCTATTGTTGAAGCATTCACTTTGTTGCTTTCACTGTACGCACCTCACTTGGCTGAGGAACTTTGTTCTTGGTTAGGACACTCAGAATTGTTGGCATACGAGTCCTTCCCCGAGGTGTGA TTCCAGGTAACCGAAGAAGTTGAAGGGACACGGTTCAACACAGGAATCTCAGCTACGATGGAGTTCGTTAACATGGCATATAGGTGGACTTACATTAAAAGGGACAGATATCCAAGGTCTATTGTTGAAGCATTCACTTTGTTGCTTTCACTGTACGCACCTCACTTGGCTGAGGAACTTTGTTCTTGGTTAGGACACTCAGAATTGTTGGCATACGAGTCCTTCCCCGAGGTGTGA FQVTEEVEGTRFNTGISATMEFVNMAYRWTYIKRDRYPRSIVEAFTLLLSLYAPHLAEELCSWLGHSELLAYESFPEV
BLAST of Carg07857 vs. NCBI nr
Match: XP_022949941.1 (leucine--tRNA ligase, chloroplastic/mitochondrial [Cucurbita moschata]) HSP 1 Score: 117.9 bits (294), Expect = 1.6e-23 Identity = 61/76 (80.26%), Postives = 65/76 (85.53%), Query Frame = 0
BLAST of Carg07857 vs. NCBI nr
Match: XP_022977986.1 (leucine--tRNA ligase, chloroplastic/mitochondrial [Cucurbita maxima]) HSP 1 Score: 117.9 bits (294), Expect = 1.6e-23 Identity = 61/76 (80.26%), Postives = 65/76 (85.53%), Query Frame = 0
BLAST of Carg07857 vs. NCBI nr
Match: XP_023544274.1 (leucine--tRNA ligase, chloroplastic/mitochondrial [Cucurbita pepo subsp. pepo]) HSP 1 Score: 117.9 bits (294), Expect = 1.6e-23 Identity = 61/76 (80.26%), Postives = 65/76 (85.53%), Query Frame = 0
BLAST of Carg07857 vs. NCBI nr
Match: XP_004134980.1 (PREDICTED: putative leucine--tRNA ligase, mitochondrial [Cucumis sativus]) HSP 1 Score: 116.7 bits (291), Expect = 3.5e-23 Identity = 60/76 (78.95%), Postives = 65/76 (85.53%), Query Frame = 0
BLAST of Carg07857 vs. NCBI nr
Match: KGN49082.1 (hypothetical protein Csa_6G513460 [Cucumis sativus]) HSP 1 Score: 116.7 bits (291), Expect = 3.5e-23 Identity = 60/76 (78.95%), Postives = 65/76 (85.53%), Query Frame = 0
BLAST of Carg07857 vs. TAIR10
Match: AT4G04350.1 (tRNA synthetase class I (I, L, M and V) family protein) HSP 1 Score: 97.4 bits (241), Expect = 4.0e-21 Identity = 49/76 (64.47%), Postives = 56/76 (73.68%), Query Frame = 0
BLAST of Carg07857 vs. Swiss-Prot
Match: sp|Q9XEA0|SYLM_ARATH (Leucine--tRNA ligase, chloroplastic/mitochondrial OS=Arabidopsis thaliana OX=3702 GN=EMB2369 PE=2 SV=1) HSP 1 Score: 97.4 bits (241), Expect = 7.3e-20 Identity = 49/76 (64.47%), Postives = 56/76 (73.68%), Query Frame = 0
BLAST of Carg07857 vs. Swiss-Prot
Match: sp|Q65FX8|SYL_BACLD (Leucine--tRNA ligase OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) OX=279010 GN=leuS PE=3 SV=1) HSP 1 Score: 77.4 bits (189), Expect = 7.8e-14 Identity = 40/75 (53.33%), Postives = 50/75 (66.67%), Query Frame = 0
BLAST of Carg07857 vs. Swiss-Prot
Match: sp|Q2S415|SYL_SALRD (Leucine--tRNA ligase OS=Salinibacter ruber (strain DSM 13855 / M31) OX=309807 GN=leuS PE=3 SV=1) HSP 1 Score: 76.3 bits (186), Expect = 1.7e-13 Identity = 39/74 (52.70%), Postives = 48/74 (64.86%), Query Frame = 0
BLAST of Carg07857 vs. Swiss-Prot
Match: sp|P36430|SYL_BACSU (Leucine--tRNA ligase OS=Bacillus subtilis (strain 168) OX=224308 GN=leuS PE=3 SV=3) HSP 1 Score: 73.2 bits (178), Expect = 1.5e-12 Identity = 39/75 (52.00%), Postives = 49/75 (65.33%), Query Frame = 0
BLAST of Carg07857 vs. Swiss-Prot
Match: sp|A8FGG0|SYL_BACP2 (Leucine--tRNA ligase OS=Bacillus pumilus (strain SAFR-032) OX=315750 GN=leuS PE=3 SV=2) HSP 1 Score: 72.4 bits (176), Expect = 2.5e-12 Identity = 38/76 (50.00%), Postives = 48/76 (63.16%), Query Frame = 0
BLAST of Carg07857 vs. TrEMBL
Match: tr|A0A0A0KL57|A0A0A0KL57_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_6G513460 PE=3 SV=1) HSP 1 Score: 116.7 bits (291), Expect = 2.3e-23 Identity = 60/76 (78.95%), Postives = 65/76 (85.53%), Query Frame = 0
BLAST of Carg07857 vs. TrEMBL
Match: tr|A0A1S3B071|A0A1S3B071_CUCME (LOW QUALITY PROTEIN: leucine--tRNA ligase, chloroplastic/mitochondrial OS=Cucumis melo OX=3656 GN=LOC103484634 PE=3 SV=1) HSP 1 Score: 114.4 bits (285), Expect = 1.2e-22 Identity = 59/76 (77.63%), Postives = 64/76 (84.21%), Query Frame = 0
BLAST of Carg07857 vs. TrEMBL
Match: tr|K4B9W8|K4B9W8_SOLLC (Uncharacterized protein OS=Solanum lycopersicum OX=4081 PE=4 SV=1) HSP 1 Score: 107.1 bits (266), Expect = 1.9e-20 Identity = 53/76 (69.74%), Postives = 61/76 (80.26%), Query Frame = 0
BLAST of Carg07857 vs. TrEMBL
Match: tr|A0A1S4DQZ2|A0A1S4DQZ2_TOBAC (leucine--tRNA ligase, chloroplastic/mitochondrial-like isoform X2 OS=Nicotiana tabacum OX=4097 GN=LOC107832508 PE=3 SV=1) HSP 1 Score: 107.1 bits (266), Expect = 1.9e-20 Identity = 53/76 (69.74%), Postives = 61/76 (80.26%), Query Frame = 0
BLAST of Carg07857 vs. TrEMBL
Match: tr|A0A1S4DR01|A0A1S4DR01_TOBAC (leucine--tRNA ligase, chloroplastic/mitochondrial-like isoform X1 OS=Nicotiana tabacum OX=4097 GN=LOC107832508 PE=3 SV=1) HSP 1 Score: 107.1 bits (266), Expect = 1.9e-20 Identity = 53/76 (69.74%), Postives = 61/76 (80.26%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of silver-seed gourd
Date Performed: 2019-03-07
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene:
The following block(s) are covering this gene:
|