Carg05953 (gene) Silver-seed gourd
The following sequences are available for this feature:
Legend: polypeptideCDSexon Hold the cursor over a type above to highlight its positions in the sequence below.ATGTGTCAAAATGACATACACTTGGACCATTATACTTATTGTAGTGTATTTAATGCCATAGCTGAGTCGGGAAAGAAGGTTCATGCCCAGGCTATAAAATCAGGATTGGAAGTGAATCATATAAGTATCTGAAATGCAGTGGCTAATGCGTATGCTAAACGTGGATCGCAGGATGATGTAAGGAAGGTTTTTTTTCAGGGTGGAAGAAAGAGATTTAGTACCTTGGACCACCCTGGTGACTGCTTATTCTCAATGTTTTGAATGGGACAAAGCAATAGAAATCTTCTCAAATATGAGAAGAGAAGGCTTTACACCCAATCAATTCTCATTTTCTAGCATGCTCGTTTCATGTGCCAGCCTTTGCTTACTCGAGTACGTCCACAAGAAGTCCATGGTATCCCCTGCAAGGTTGGCTTGGATATGA ATGTGTCAAAATGACATACACTTGGACCATTATACTTATTGTAGTGTATTTAATGCCATAGCTGAGTCGGGAAAGAAGGTTCATGCCCAGGCTATAAAATCAGGATTGGAATGGCTAATGCGTATGCTAAACGTGGATCGCAGGATGATGGTGGAAGAAAGAGATTTAGTACCTTGGACCACCCTGGTGACTGCTTATTCTCAATGTTTTGAATGGGACAAAGCAATAGAAATCTTCTCAAATATGAGAAGAGAAGGCTTTACACCCAATCAATTCTCATTTTCTAGCATGCTCGTTTCATGTGCCAGCCTTTGCTTACTCGAGTACGTCCACAAGAAGTCCATGGTATCCCCTGCAAGGTTGGCTTGGATATGA ATGTGTCAAAATGACATACACTTGGACCATTATACTTATTGTAGTGTATTTAATGCCATAGCTGAGTCGGGAAAGAAGGTTCATGCCCAGGCTATAAAATCAGGATTGGAATGGCTAATGCGTATGCTAAACGTGGATCGCAGGATGATGGTGGAAGAAAGAGATTTAGTACCTTGGACCACCCTGGTGACTGCTTATTCTCAATGTTTTGAATGGGACAAAGCAATAGAAATCTTCTCAAATATGAGAAGAGAAGGCTTTACACCCAATCAATTCTCATTTTCTAGCATGCTCGTTTCATGTGCCAGCCTTTGCTTACTCGAGTACGTCCACAAGAAGTCCATGGTATCCCCTGCAAGGTTGGCTTGGATATGA MCQNDIHLDHYTYCSVFNAIAESGKKVHAQAIKSGLEWLMRMLNVDRRMMVEERDLVPWTTLVTAYSQCFEWDKAIEIFSNMRREGFTPNQFSFSSMLVSCASLCLLEYVHKKSMVSPARLAWI
BLAST of Carg05953 vs. NCBI nr
Match: XP_016901974.1 (PREDICTED: pentatricopeptide repeat-containing protein At2g27610-like [Cucumis melo]) HSP 1 Score: 154.8 bits (390), Expect = 1.9e-34 Identity = 84/132 (63.64%), Postives = 94/132 (71.21%), Query Frame = 0
BLAST of Carg05953 vs. NCBI nr
Match: KGN45817.1 (hypothetical protein Csa_6G013890 [Cucumis sativus]) HSP 1 Score: 154.1 bits (388), Expect = 3.2e-34 Identity = 84/132 (63.64%), Postives = 93/132 (70.45%), Query Frame = 0
BLAST of Carg05953 vs. NCBI nr
Match: XP_011656423.1 (PREDICTED: putative pentatricopeptide repeat-containing protein At3g25970 [Cucumis sativus]) HSP 1 Score: 154.1 bits (388), Expect = 3.2e-34 Identity = 84/132 (63.64%), Postives = 93/132 (70.45%), Query Frame = 0
BLAST of Carg05953 vs. NCBI nr
Match: XP_022993736.1 (pentatricopeptide repeat-containing protein At2g27610-like [Cucurbita maxima]) HSP 1 Score: 154.1 bits (388), Expect = 3.2e-34 Identity = 82/132 (62.12%), Postives = 93/132 (70.45%), Query Frame = 0
BLAST of Carg05953 vs. NCBI nr
Match: XP_023549692.1 (pentatricopeptide repeat-containing protein At3g16610-like [Cucurbita pepo subsp. pepo]) HSP 1 Score: 154.1 bits (388), Expect = 3.2e-34 Identity = 82/132 (62.12%), Postives = 93/132 (70.45%), Query Frame = 0
BLAST of Carg05953 vs. TAIR10
Match: AT4G39530.1 (Tetratricopeptide repeat (TPR)-like superfamily protein) HSP 1 Score: 58.5 bits (140), Expect = 3.3e-09 Identity = 36/129 (27.91%), Postives = 68/129 (52.71%), Query Frame = 0
BLAST of Carg05953 vs. TAIR10
Match: AT3G02330.1 (Pentatricopeptide repeat (PPR) superfamily protein) HSP 1 Score: 57.0 bits (136), Expect = 9.6e-09 Identity = 40/128 (31.25%), Postives = 65/128 (50.78%), Query Frame = 0
BLAST of Carg05953 vs. TAIR10
Match: AT3G47840.1 (Tetratricopeptide repeat (TPR)-like superfamily protein) HSP 1 Score: 56.2 bits (134), Expect = 1.6e-08 Identity = 38/119 (31.93%), Postives = 53/119 (44.54%), Query Frame = 0
BLAST of Carg05953 vs. TAIR10
Match: AT3G61170.1 (Tetratricopeptide repeat (TPR)-like superfamily protein) HSP 1 Score: 55.8 bits (133), Expect = 2.1e-08 Identity = 33/97 (34.02%), Postives = 53/97 (54.64%), Query Frame = 0
BLAST of Carg05953 vs. TAIR10
Match: AT3G49740.1 (Tetratricopeptide repeat (TPR)-like superfamily protein) HSP 1 Score: 54.7 bits (130), Expect = 4.8e-08 Identity = 35/116 (30.17%), Postives = 56/116 (48.28%), Query Frame = 0
BLAST of Carg05953 vs. Swiss-Prot
Match: sp|Q9SVA5|PP357_ARATH (Pentatricopeptide repeat-containing protein At4g39530 OS=Arabidopsis thaliana OX=3702 GN=PCMP-E52 PE=3 SV=1) HSP 1 Score: 58.5 bits (140), Expect = 5.9e-08 Identity = 36/129 (27.91%), Postives = 68/129 (52.71%), Query Frame = 0
BLAST of Carg05953 vs. Swiss-Prot
Match: sp|Q9FWA6|PP207_ARATH (Pentatricopeptide repeat-containing protein At3g02330, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=PCMP-E90 PE=2 SV=2) HSP 1 Score: 57.0 bits (136), Expect = 1.7e-07 Identity = 40/128 (31.25%), Postives = 65/128 (50.78%), Query Frame = 0
BLAST of Carg05953 vs. Swiss-Prot
Match: sp|Q9STS9|PP268_ARATH (Putative pentatricopeptide repeat-containing protein At3g47840 OS=Arabidopsis thaliana OX=3702 GN=PCMP-E43 PE=3 SV=1) HSP 1 Score: 56.2 bits (134), Expect = 2.9e-07 Identity = 38/119 (31.93%), Postives = 53/119 (44.54%), Query Frame = 0
BLAST of Carg05953 vs. Swiss-Prot
Match: sp|Q9M2Y4|PP276_ARATH (Pentatricopeptide repeat-containing protein At3g49740 OS=Arabidopsis thaliana OX=3702 GN=PCMP-E84 PE=2 SV=1) HSP 1 Score: 54.7 bits (130), Expect = 8.6e-07 Identity = 35/116 (30.17%), Postives = 56/116 (48.28%), Query Frame = 0
BLAST of Carg05953 vs. Swiss-Prot
Match: sp|Q9LSL8|PP446_ARATH (Pentatricopeptide repeat-containing protein At5g65570 OS=Arabidopsis thaliana OX=3702 GN=PCMP-H47 PE=2 SV=1) HSP 1 Score: 54.3 bits (129), Expect = 1.1e-06 Identity = 41/128 (32.03%), Postives = 65/128 (50.78%), Query Frame = 0
BLAST of Carg05953 vs. TrEMBL
Match: tr|A0A1S4E171|A0A1S4E171_CUCME (pentatricopeptide repeat-containing protein At2g27610-like OS=Cucumis melo OX=3656 GN=LOC103496600 PE=4 SV=1) HSP 1 Score: 154.8 bits (390), Expect = 1.2e-34 Identity = 84/132 (63.64%), Postives = 94/132 (71.21%), Query Frame = 0
BLAST of Carg05953 vs. TrEMBL
Match: tr|A0A0A0KBQ4|A0A0A0KBQ4_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_6G013890 PE=4 SV=1) HSP 1 Score: 154.1 bits (388), Expect = 2.1e-34 Identity = 84/132 (63.64%), Postives = 93/132 (70.45%), Query Frame = 0
BLAST of Carg05953 vs. TrEMBL
Match: tr|A0A2P4H490|A0A2P4H490_QUESU (Pentatricopeptide repeat-containing protein OS=Quercus suber OX=58331 GN=CFP56_58366 PE=4 SV=1) HSP 1 Score: 134.0 bits (336), Expect = 2.3e-28 Identity = 72/135 (53.33%), Postives = 89/135 (65.93%), Query Frame = 0
BLAST of Carg05953 vs. TrEMBL
Match: tr|A0A2I4FUM6|A0A2I4FUM6_9ROSI (putative pentatricopeptide repeat-containing protein At1g56570 OS=Juglans regia OX=51240 GN=LOC109002176 PE=4 SV=1) HSP 1 Score: 133.7 bits (335), Expect = 2.9e-28 Identity = 72/133 (54.14%), Postives = 88/133 (66.17%), Query Frame = 0
BLAST of Carg05953 vs. TrEMBL
Match: tr|A0A251QLP4|A0A251QLP4_PRUPE (Uncharacterized protein OS=Prunus persica OX=3760 GN=PRUPE_2G259700 PE=4 SV=1) HSP 1 Score: 127.1 bits (318), Expect = 2.8e-26 Identity = 69/132 (52.27%), Postives = 85/132 (64.39%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of silver-seed gourd
Date Performed: 2019-03-07
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene: |