Carg04914 (gene) Silver-seed gourd
The following sequences are available for this feature:
Legend: polypeptideexonCDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGCTCGTACTAAGCAAACTGCTCGTAAATCCACCGGCGGTAAGGCTCCGAGGAAGCAGCTAGCGACGAAGGCCGCTCGGAAATCAGCTCCTGCAACGGGAGGAGTGAAGAAGCCGCATAGGTTTAGGCCGGGAACGGTGGCGCTGAGGGAAATTAGAAAGTACCAGAAGAGCACCGAGCTTCTAATCCGCAAGCTTCCGTTCCAGCGGCTCGTTAGAGAGATCGCTCAGGACTTCAAGACCGATCTCCGGTTCCAAAGCAGCGCCGTAGCAGCGTTGCAGGAGGCGGCAGAAGCCTATCTCGTCGGATTGTTCGAGGATACTAACCTCTGCGCAATTCATGCTAAGAGAGTTACGATTATGCCGAAGGATATTCAATTGGCGAGAAGAATTAGAGGTGAGAGAGCTTAGATGGCTCGTACTAAGCAAACTGCTCGTAAATCCACCGGCGGTAAGGCTCCGAGGAAGCAGCTAGCGACGAAGGCCGCTCGGAAATCAGCTCCTGCAACGGGAGGAGTGAAGAAGCCGCATAGGTTTAGGCCGGGAACGGTGGCGCTGAGGGAAATTAGAAAGTACCAGAAGAGCACCGAGCTTCTAATCCGCAAGCTTCCGTTCCAGCGGCTCGTTAGAGAGATCGCTCAGGACTTCAAGACCGATCTCCGGTTCCAAAGCAGCGCCGTAGCAGCGTTGCAGGAGGCGGCAGAAGCCTATCTCGTCGGATTGTTCGAGGATACTAACCTCTGCGCAATTCATGCTAAGAGAGTTACGATTATGCCGAAGGATATTCAATTGGCGAGAAGAATTAGAGGTGAGAGAGCTTAG ATGGCTCGTACTAAGCAAACTGCTCGTAAATCCACCGGCGGTAAGGCTCCGAGGAAGCAGCTAGCGACGAAGGCCGCTCGGAAATCAGCTCCTGCAACGGGAGGAGTGAAGAAGCCGCATAGGTTTAGGCCGGGAACGGTGGCGCTGAGGGAAATTAGAAAGTACCAGAAGAGCACCGAGCTTCTAATCCGCAAGCTTCCGTTCCAGCGGCTCGTTAGAGAGATCGCTCAGGACTTCAAGACCGATCTCCGGTTCCAAAGCAGCGCCGTAGCAGCGTTGCAGGAGGCGGCAGAAGCCTATCTCGTCGGATTGTTCGAGGATACTAACCTCTGCGCAATTCATGCTAAGAGAGTTACGATTATGCCGAAGGATATTCAATTGGCGAGAAGAATTAGAGGTGAGAGAGCTTAG MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVAALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
BLAST of Carg04914 vs. NCBI nr
Match: AQK43641.1 (Histone H3.2 [Zea mays]) HSP 1 Score: 253.4 bits (646), Expect = 4.2e-64 Identity = 136/136 (100.00%), Postives = 136/136 (100.00%), Query Frame = 0
BLAST of Carg04914 vs. NCBI nr
Match: XP_008669425.1 (histone H3.2 [Zea mays]) HSP 1 Score: 253.4 bits (646), Expect = 4.2e-64 Identity = 136/136 (100.00%), Postives = 136/136 (100.00%), Query Frame = 0
BLAST of Carg04914 vs. NCBI nr
Match: NP_189372.1 (Histone superfamily protein [Arabidopsis thaliana] >NP_201339.1 Histone superfamily protein [Arabidopsis thaliana] >NP_563838.1 Histone superfamily protein [Arabidopsis thaliana] >NP_568227.1 Histone superfamily protein [Arabidopsis thaliana] >NP_568228.1 Histone superfamily protein [Arabidopsis thaliana] >NP_001131276.1 histone H3.2 [Zea mays] >XP_002299242.1 histone H3.2 [Populus trichocarpa] >XP_002304754.1 histone H3.2 [Populus trichocarpa] >XP_002282606.1 PREDICTED: histone H3.2 [Vitis vinifera] >XP_002285556.1 PREDICTED: histone H3.2 [Vitis vinifera] >XP_002285562.1 PREDICTED: histone H3.2 [Vitis vinifera] >XP_002264961.1 PREDICTED: histone H3.2 [Vitis vinifera] >XP_002457320.1 histone H3.2 [Sorghum bicolor] >XP_002452234.1 histone H3.2 [Sorghum bicolor] >XP_002446458.1 histone H3.2 [Sorghum bicolor] >XP_002447846.1 histone H3.2 [Sorghum bicolor] >XP_002441172.1 histone H3.2 [Sorghum bicolor] >XP_002436522.1 histone H3.2 [Sorghum bicolor] >XP_002437869.1 histone H3.2 [Sorghum bicolor] >XP_002522502.1 histone H3.2 [Ricinus communis] >XP_002524630.1 histone H3.2 [Ricinus communis] >XP_002533558.1 histone H3.2 [Ricinus communis] >XP_002533561.1 histone H3.2 [Ricinus communis] >XP_002533563.1 histone H3.2 [Ricinus communis] >XP_002533564.1 histone H3.2 [Ricinus communis] >XP_002873454.1 histone H3.2 [Arabidopsis lyrata subsp. lyrata] >XP_002894648.1 histone H3.2 [Arabidopsis lyrata subsp. lyrata] >XP_004142133.1 PREDICTED: histone H3.2 [Cucumis sativus] >XP_004229355.1 histone H3.2 [Solanum lycopersicum] >XP_004229356.1 histone H3.2 [Solanum lycopersicum] >XP_004229488.1 histone H3.2 [Solanum lycopersicum] >XP_004248123.1 histone H3.2 [Solanum lycopersicum] >XP_004293906.1 PREDICTED: histone H3.2 [Fragaria vesca subsp. vesca] >XP_004294584.1 PREDICTED: histone H3.2 [Fragaria vesca subsp. vesca] >XP_004294793.1 PREDICTED: histone H3.2 [Fragaria vesca subsp. vesca] >XP_004295221.1 PREDICTED: histone H3.2 [Fragaria vesca subsp. vesca] >XP_004300433.1 PREDICTED: histone H3.2 [Fragaria vesca subsp. vesca] >XP_004952690.1 histone H3.2 [Setaria italica] >XP_004970697.1 histone H3.2 [Setaria italica] >XP_004975679.1 histone H3.2 [Setaria italica] >XP_006359169.1 PREDICTED: histone H3.2 [Solanum tuberosum] >XP_006359170.1 PREDICTED: histone H3.2 [Solanum tuberosum] >XP_006361042.1 PREDICTED: histone H3.2 [Solanum tuberosum] >XP_006364319.1 PREDICTED: histone H3.2 [Solanum tuberosum] >XP_006365266.1 PREDICTED: histone H3.2 [Solanum tuberosum] >XP_006366504.1 PREDICTED: histone H3.2 [Solanum tuberosum] >XP_006366505.1 PREDICTED: histone H3.2 [Solanum tuberosum] >XP_006292533.1 histone H3.2 [Capsella rubella] >XP_006304637.1 histone H3.2 [Capsella rubella] >XP_006386195.1 histone H3.2 [Populus trichocarpa] >XP_006386111.1 histone H3.2 [Populus trichocarpa] >XP_002320408.2 histone H3.2 [Populus trichocarpa] >XP_006394044.1 histone H3.2 [Eutrema salsugineum] >XP_006394194.1 histone H3.2 [Eutrema salsugineum] >XP_006396911.1 histone H3.2 [Eutrema salsugineum] >XP_006426310.1 histone H3.2 [Citrus clementina] >XP_006446007.1 histone H3.2 [Citrus clementina] >XP_006446012.1 histone H3.2 [Citrus clementina] >XP_006446027.1 histone H3.2 [Citrus clementina] >XP_006466277.1 histone H3.2 [Citrus sinensis] >XP_006493650.1 histone H3.2 [Citrus sinensis] >XP_006493653.1 histone H3.2 isoform X1 [Citrus sinensis] >XP_006493654.1 histone H3.2 isoform X2 [Citrus sinensis] >XP_006493658.1 histone H3.2 isoform X1 [Citrus sinensis] >XP_006493659.1 histone H3.2 isoform X2 [Citrus sinensis] >XP_006656199.1 PREDICTED: histone H3.2 [Oryza brachyantha] >XP_006662745.1 PREDICTED: histone H3.2 [Oryza brachyantha] >XP_006827607.1 histone H3.2 [Amborella trichopoda] >XP_006854535.1 histone H3.2 [Amborella trichopoda] >XP_007014937.1 PREDICTED: histone H3.2 [Theobroma cacao] >XP_007047838.1 PREDICTED: histone H3.2 [Theobroma cacao] >XP_007206130.1 histone H3.2 [Prunus persica] >XP_007206131.1 histone H3.2 [Prunus persica] >XP_007213974.1 histone H3.2 [Prunus persica] >XP_008219239.1 PREDICTED: histone H3.2 [Prunus mume] >XP_008219284.1 PREDICTED: histone H3.2 [Prunus mume] >XP_008243610.1 PREDICTED: histone H3.2 [Prunus mume] >XP_008245364.1 PREDICTED: histone H3.2 [Prunus mume] >XP_008383674.1 PREDICTED: histone H3.2 [Malus domestica] >XP_008384460.1 PREDICTED: histone H3.2 [Malus domestica] >XP_008384469.1 PREDICTED: histone H3.2 [Malus domestica] >XP_008349461.1 PREDICTED: histone H3.2 [Malus domestica] >XP_008358867.1 PREDICTED: histone H3.2 [Malus domestica] >XP_008366176.1 PREDICTED: histone H3.2 [Malus domestica] >XP_008449740.1 PREDICTED: histone H3.2 [Cucumis melo] >XP_008466947.1 PREDICTED: histone H3.2 [Cucumis melo] >XP_008678686.1 histone H3.2 [Zea mays] >XP_008659267.1 histone H3.2 [Zea mays] >XP_008777421.1 PREDICTED: histone H3.2 [Phoenix dactylifera] >XP_008781402.1 PREDICTED: histone H3.2 [Phoenix dactylifera] >XP_008793940.1 PREDICTED: histone H3.2 [Phoenix dactylifera] >XP_009125303.1 PREDICTED: histone H3.2 [Brassica rapa] >XP_009131154.1 PREDICTED: histone H3.2 [Brassica rapa] >XP_009110843.1 PREDICTED: histone H3.2 [Brassica rapa] >XP_009112178.1 PREDICTED: histone H3.2 [Brassica rapa] >XP_009114048.1 PREDICTED: histone H3.2 [Brassica rapa] >XP_009374897.1 PREDICTED: histone H3.2 [Pyrus x bretschneideri] >XP_009352838.1 PREDICTED: histone H3.2 [Pyrus x bretschneideri] >XP_009364707.1 PREDICTED: histone H3.2 [Pyrus x bretschneideri] >XP_009364738.1 PREDICTED: histone H3.2 [Pyrus x bretschneideri] >XP_009379413.1 PREDICTED: histone H3.2 [Pyrus x bretschneideri] >XP_009418349.1 PREDICTED: histone H3.2 [Musa acuminata subsp. malaccensis] >XP_009399186.1 PREDICTED: histone H3.2 [Musa acuminata subsp. malaccensis] >XP_009404906.1 PREDICTED: histone H3.2 [Musa acuminata subsp. malaccensis] >XP_009405329.1 PREDICTED: histone H3.2 [Musa acuminata subsp. malaccensis] >XP_009411937.1 PREDICTED: histone H3.2 [Musa acuminata subsp. malaccensis] >XP_009420590.1 PREDICTED: histone H3.2 [Musa acuminata subsp. malaccensis] >XP_009612389.1 PREDICTED: histone H3.2 [Nicotiana tomentosiformis] >XP_009588612.1 PREDICTED: histone H3.2 [Nicotiana tomentosiformis] >XP_009588620.1 PREDICTED: histone H3.2 [Nicotiana tomentosiformis] >XP_009589159.1 PREDICTED: histone H3.2 [Nicotiana tomentosiformis] >XP_009594168.1 PREDICTED: histone H3.2 [Nicotiana tomentosiformis] >XP_009597397.1 PREDICTED: histone H3.2 [Nicotiana tomentosiformis] >XP_009795193.1 PREDICTED: histone H3.2 [Nicotiana sylvestris] >XP_009790377.1 PREDICTED: histone H3.2 [Nicotiana sylvestris] >XP_009792014.1 PREDICTED: histone H3.2 [Nicotiana sylvestris] >XP_009794411.1 PREDICTED: histone H3.2 [Nicotiana sylvestris] >XP_009794577.1 PREDICTED: histone H3.2 [Nicotiana sylvestris] >XP_009800087.1 PREDICTED: histone H3.2 [Nicotiana sylvestris] >XP_009768852.1 PREDICTED: histone H3.2 [Nicotiana sylvestris] >XP_009776512.1 PREDICTED: histone H3.2 [Nicotiana sylvestris] >XP_010044997.1 PREDICTED: histone H3.2 [Eucalyptus grandis] >XP_010031842.1 PREDICTED: histone H3.2 [Eucalyptus grandis] >XP_010033130.1 PREDICTED: histone H3.2 [Eucalyptus grandis] >XP_010087371.1 histone H3.2 [Morus notabilis] >XP_010087372.1 histone H3.2 [Morus notabilis] >XP_010091983.1 histone H3.2 [Morus notabilis] >XP_010091985.1 histone H3.2 [Morus notabilis] >XP_010111157.1 histone H3.2 [Morus notabilis] >XP_010257371.1 PREDICTED: histone H3.2 [Nelumbo nucifera] >XP_010257381.1 PREDICTED: histone H3.2 [Nelumbo nucifera] >XP_010258545.1 PREDICTED: histone H3.2 [Nelumbo nucifera] >XP_010260368.1 PREDICTED: histone H3.2 [Nelumbo nucifera] >XP_010260930.1 PREDICTED: histone H3.2 [Nelumbo nucifera] >XP_010263130.1 PREDICTED: histone H3.2 [Nelumbo nucifera] >XP_010265797.1 PREDICTED: histone H3.2 [Nelumbo nucifera] >XP_010241721.1 PREDICTED: histone H3.2 [Nelumbo nucifera] >XP_010324306.1 histone H3.2 [Solanum lycopersicum] >XP_010316780.1 histone H3.2 [Solanum lycopersicum] >XP_010463183.1 PREDICTED: histone H3.2 [Camelina sativa] >XP_010489841.1 PREDICTED: histone H3.2 [Camelina sativa] >XP_010502711.1 PREDICTED: histone H3.2 [Camelina sativa] >XP_010514443.1 PREDICTED: histone H3.2 [Camelina sativa] >XP_010425488.1 PREDICTED: histone H3.2 [Camelina sativa] >XP_010444536.1 PREDICTED: histone H3.2 [Camelina sativa] >XP_010458200.1 PREDICTED: histone H3.2 [Camelina sativa] >XP_010475747.1 PREDICTED: histone H3.2 [Camelina sativa] >XP_010484375.1 PREDICTED: histone H3.2 [Camelina sativa] >XP_010536065.1 PREDICTED: histone H3.2 [Tarenaya hassleriana] >XP_010544196.1 PREDICTED: histone H3.2 [Tarenaya hassleriana] >XP_010673587.1 PREDICTED: histone H3.2 [Beta vulgaris subsp. vulgaris] >XP_010673590.1 PREDICTED: histone H3.2 [Beta vulgaris subsp. vulgaris] >XP_010675450.1 PREDICTED: histone H3.2 [Beta vulgaris subsp. vulgaris] >XP_010675457.1 PREDICTED: histone H3.2 [Beta vulgaris subsp. vulgaris] >XP_010675458.1 PREDICTED: histone H3.2 [Beta vulgaris subsp. vulgaris] >XP_010679903.1 PREDICTED: histone H3.2 [Beta vulgaris subsp. vulgaris] >XP_010911970.1 PREDICTED: histone H3.2 [Elaeis guineensis] >XP_010912408.1 PREDICTED: histone H3.2 [Elaeis guineensis] >XP_011037963.1 PREDICTED: histone H3.2 [Populus euphratica] >XP_010930992.1 PREDICTED: histone H3.2 [Elaeis guineensis] >XP_011028938.1 PREDICTED: histone H3.2 [Populus euphratica] >XP_010904890.1 PREDICTED: histone H3.2 [Elaeis guineensis] >XP_011037873.1 PREDICTED: histone H3.2 [Populus euphratica] >XP_011037877.1 PREDICTED: histone H3.2 [Populus euphratica] >XP_011042066.1 PREDICTED: histone H3.2 [Populus euphratica] >XP_011042070.1 PREDICTED: histone H3.2 [Populus euphratica] >XP_011087280.1 histone H3.2 [Sesamum indicum] >XP_011080254.1 histone H3.2 [Sesamum indicum] >XP_011090392.1 histone H3.2 [Sesamum indicum] >XP_011092467.1 histone H3.2 [Sesamum indicum] >XP_011093538.1 histone H3.2 [Sesamum indicum] >XP_011463287.1 PREDICTED: histone H3.2 [Fragaria vesca subsp. vesca] >XP_004139024.2 PREDICTED: histone H3.2 [Cucumis sativus] >XP_012071958.1 histone H3.2 [Jatropha curcas] >XP_012091683.1 histone H3.2 [Jatropha curcas] >XP_012092773.1 histone H3.2 [Jatropha curcas] >XP_012092775.1 histone H3.2 [Jatropha curcas] >XP_012473340.1 PREDICTED: histone H3.2 [Gossypium raimondii] >XP_012477143.1 PREDICTED: histone H3.2 [Gossypium raimondii] >XP_012477145.1 PREDICTED: histone H3.2 [Gossypium raimondii] >XP_012447072.1 PREDICTED: histone H3.2 [Gossypium raimondii] >XP_012452274.1 PREDICTED: histone H3.2 [Gossypium raimondii] >XP_012455372.1 PREDICTED: histone H3.2 [Gossypium raimondii] >XP_012456013.1 PREDICTED: histone H3.2 [Gossypium raimondii] >XP_012464460.1 PREDICTED: histone H3.2 [Gossypium raimondii] >XP_012465103.1 PREDICTED: histone H3.2 [Gossypium raimondii] >XP_012700296.1 histone H3.2 [Setaria italica] >XP_012700964.1 histone H3.2 [Setaria italica] >XP_012829914.1 PREDICTED: histone H3.2 [Erythranthe guttata] >XP_012830336.1 PREDICTED: histone H3.2 [Erythranthe guttata] >XP_012835372.1 PREDICTED: histone H3.2 [Erythranthe guttata] >XP_012849881.1 PREDICTED: histone H3.2 [Erythranthe guttata] >XP_012828407.1 PREDICTED: histone H3.2 [Erythranthe guttata] >XP_012829025.1 PREDICTED: histone H3.2 [Erythranthe guttata] >XP_013618388.1 PREDICTED: histone H3.2 [Brassica oleracea var. oleracea] >XP_013621521.1 PREDICTED: histone H3.2 [Brassica oleracea var. oleracea] >XP_013637372.1 PREDICTED: histone H3.2 [Brassica oleracea var. oleracea] >XP_013599938.1 PREDICTED: histone H3.2 [Brassica oleracea var. oleracea] >XP_013606481.1 PREDICTED: histone H3.2 [Brassica oleracea var. oleracea] >XP_013609086.1 PREDICTED: histone H3.2 [Brassica oleracea var. oleracea] >XP_013678750.1 histone H3.2 [Brassica napus] >XP_013726586.1 histone H3.2 [Brassica napus] >XP_013738537.1 histone H3.2 [Brassica napus] >XP_013742827.1 histone H3.2 [Brassica napus] >XP_013742828.1 histone H3.2 [Brassica napus] >XP_013750874.1 histone H3.2 [Brassica napus] >XP_013657686.1 histone H3.2 [Brassica napus] >XP_013680280.1 histone H3.2 [Brassica napus] >XP_013686742.1 histone H3.2 [Brassica napus] >XP_013686753.1 histone H3.2 [Brassica napus] >XP_013698649.1 histone H3.2 [Brassica napus] >XP_013700674.1 histone H3.2 [Brassica napus] >XP_013700675.1 histone H3.2 [Brassica napus] >XP_013700676.1 histone H3.2 [Brassica napus] >XP_013712760.1 histone H3.2 [Brassica napus] >XP_013718218.1 histone H3.2 [Brassica napus] >XP_013718219.1 histone H3.2 [Brassica napus] >XP_013731494.1 histone H3.2 [Brassica napus] >XP_013733475.1 histone H3.2 [Brassica napus] >XP_014660475.1 histone H3.2 [Setaria italica] >XP_015062471.1 PREDICTED: histone H3.2 [Solanum pennellii] >XP_015062551.1 PREDICTED: histone H3.2 [Solanum pennellii] >XP_015060267.1 PREDICTED: histone H3.2 [Solanum pennellii] >XP_015060270.1 PREDICTED: histone H3.2 [Solanum pennellii] >XP_015063022.1 PREDICTED: histone H3.2 [Solanum pennellii] >XP_015063120.1 PREDICTED: histone H3.2 [Solanum pennellii] >XP_015066930.1 PREDICTED: histone H3.2 [Solanum pennellii] >XP_015088813.1 PREDICTED: histone H3.2 [Solanum pennellii] >XP_015641515.1 histone H3.2 [Oryza sativa Japonica Group] >XP_015639714.1 histone H3.2 [Oryza sativa Japonica Group] >XP_015642925.1 histone H3.2 [Oryza sativa Japonica Group] >XP_015642926.1 histone H3.2 [Oryza sativa Japonica Group] >XP_015642927.1 histone H3.2 [Oryza sativa Japonica Group] >XP_015615109.1 histone H3.2 [Oryza sativa Japonica Group] >XP_015890987.1 histone H3.2 [Ziziphus jujuba] >XP_015875930.1 histone H3.2 [Ziziphus jujuba] >XP_015867123.1 histone H3.2 [Ziziphus jujuba] >XP_015867128.1 histone H3.2 [Ziziphus jujuba] >XP_015956408.1 histone H3.2 [Arachis duranensis] >XP_015962680.1 histone H3.2 [Arachis duranensis] >XP_015945242.1 histone H3.2 [Arachis duranensis] >XP_016190032.1 histone H3.2 [Arachis ipaensis] >XP_016194363.1 histone H3.2 [Arachis ipaensis] >XP_016181780.1 histone H3.2 [Arachis ipaensis] >XP_016182163.1 histone H3.2 [Arachis ipaensis] >XP_016444277.1 PREDICTED: histone H3.2 [Nicotiana tabacum] >XP_016472604.1 PREDICTED: histone H3.2 [Nicotiana tabacum] >XP_016476898.1 PREDICTED: histone H3.2 [Nicotiana tabacum] >XP_016497746.1 PREDICTED: histone H3.2 [Nicotiana tabacum] >XP_016497344.1 PREDICTED: histone H3.2 [Nicotiana tabacum] >XP_016498067.1 PREDICTED: histone H3.2 [Nicotiana tabacum] >XP_016498068.1 PREDICTED: histone H3.2 [Nicotiana tabacum] >XP_016500339.1 PREDICTED: histone H3.2 [Nicotiana tabacum] >XP_016502252.1 PREDICTED: histone H3.2 [Nicotiana tabacum] >XP_016506905.1 PREDICTED: histone H3.2 [Nicotiana tabacum] >XP_016432905.1 PREDICTED: histone H3.2 [Nicotiana tabacum] >XP_016437038.1 PREDICTED: histone H3.2 [Nicotiana tabacum] >XP_016514570.1 PREDICTED: histone H3.2 [Nicotiana tabacum] >XP_016432553.1 PREDICTED: histone H3.2 [Nicotiana tabacum] >XP_016438522.1 PREDICTED: histone H3.2 [Nicotiana tabacum] >XP_016554942.1 PREDICTED: histone H3.2 [Capsicum annuum] >XP_016557393.1 PREDICTED: histone H3.2 [Capsicum annuum] >XP_016557394.1 PREDICTED: histone H3.2 [Capsicum annuum] >XP_016541463.1 PREDICTED: histone H3.2 [Capsicum annuum] >XP_016559802.1 PREDICTED: histone H3.2 [Capsicum annuum] >XP_016551871.1 PREDICTED: histone H3.2 [Capsicum annuum] >XP_016717625.1 PREDICTED: histone H3.2 [Gossypium hirsutum] >XP_016734760.1 PREDICTED: histone H3.2 [Gossypium hirsutum] >XP_016753413.1 PREDICTED: histone H3.2 [Gossypium hirsutum] >XP_016678479.1 PREDICTED: histone H3.2 [Gossypium hirsutum] >XP_016679592.1 PREDICTED: histone H3.2 [Gossypium hirsutum] >XP_016683567.1 PREDICTED: histone H3.2 [Gossypium hirsutum] >XP_016690176.1 PREDICTED: histone H3.2 [Gossypium hirsutum] >XP_016697979.1 PREDICTED: histone H3.2 [Gossypium hirsutum] >XP_016698756.1 PREDICTED: histone H3.2 [Gossypium hirsutum] >XP_016703464.1 PREDICTED: histone H3.2 [Gossypium hirsutum] >XP_016706622.1 PREDICTED: histone H3.2 [Gossypium hirsutum] >XP_017182452.1 PREDICTED: histone H3.2 [Malus domestica] >XP_017185745.1 PREDICTED: histone H3.2 [Malus domestica] >XP_017234420.1 PREDICTED: histone H3.2 [Daucus carota subsp. sativus] >XP_017236362.1 PREDICTED: histone H3.2 [Daucus carota subsp. sativus] >XP_017258634.1 PREDICTED: histone H3.2 [Daucus carota subsp. sativus] >XP_017232071.1 PREDICTED: histone H3.2 [Daucus carota subsp. sativus] >XP_017234599.1 PREDICTED: histone H3.2 [Daucus carota subsp. sativus] >XP_017234600.1 PREDICTED: histone H3.2 [Daucus carota subsp. sativus] >XP_017226888.1 PREDICTED: histone H3.2 [Daucus carota subsp. sativus] >XP_017621199.1 PREDICTED: histone H3.2 [Gossypium arboreum] >XP_017605698.1 PREDICTED: histone H3.2 [Gossypium arboreum] >XP_017643103.1 PREDICTED: histone H3.2 [Gossypium arboreum] >XP_017646801.1 PREDICTED: histone H3.2 [Gossypium arboreum] >XP_017648889.1 PREDICTED: histone H3.2 [Gossypium arboreum] >XP_017980785.1 PREDICTED: histone H3.2 [Theobroma cacao] >XP_017981975.1 PREDICTED: histone H3.2 [Theobroma cacao] >XP_007014942.2 PREDICTED: histone H3.2 [Theobroma cacao] >XP_018470661.1 PREDICTED: histone H3.2 [Raphanus sativus] >XP_018470662.1 PREDICTED: histone H3.2 [Raphanus sativus] >XP_018433979.1 PREDICTED: histone H3.2 [Raphanus sativus] >XP_018439713.1 PREDICTED: histone H3.2 [Raphanus sativus] >XP_018445234.1 PREDICTED: histone H3.2 [Raphanus sativus] >XP_018448989.1 PREDICTED: histone H3.2 [Raphanus sativus] >XP_018448990.1 PREDICTED: histone H3.2 [Raphanus sativus] >XP_018456938.1 PREDICTED: histone H3.2 [Raphanus sativus] >XP_018456939.1 PREDICTED: histone H3.2 [Raphanus sativus] >XP_018622827.1 PREDICTED: histone H3.2 [Nicotiana tomentosiformis] >XP_018727385.1 PREDICTED: histone H3.2 [Eucalyptus grandis] >XP_018851506.1 PREDICTED: histone H3.2 [Juglans regia] >XP_019059186.1 PREDICTED: histone H3.2 [Tarenaya hassleriana] >XP_019072373.1 PREDICTED: histone H3.2 [Vitis vinifera] >XP_019186829.1 PREDICTED: histone H3.2 [Ipomoea nil] >XP_019152654.1 PREDICTED: histone H3.2 [Ipomoea nil] >XP_019152661.1 PREDICTED: histone H3.2 [Ipomoea nil] >XP_019152669.1 PREDICTED: histone H3.2 [Ipomoea nil] >XP_019168898.1 PREDICTED: histone H3.2 [Ipomoea nil] >XP_019197722.1 PREDICTED: histone H3.2 [Ipomoea nil] >XP_019168634.1 PREDICTED: histone H3.2 [Ipomoea nil] >XP_019265433.1 PREDICTED: histone H3.2 [Nicotiana attenuata] >XP_019267355.1 PREDICTED: histone H3.2 [Nicotiana attenuata] >XP_019223782.1 PREDICTED: histone H3.2 [Nicotiana attenuata] >XP_019223783.1 PREDICTED: histone H3.2 [Nicotiana attenuata] >XP_019230430.1 PREDICTED: histone H3.2 [Nicotiana attenuata] >XP_019241236.1 PREDICTED: histone H3.2 [Nicotiana attenuata] >XP_019226053.1 PREDICTED: histone H3.2 [Nicotiana attenuata] >XP_019246841.1 PREDICTED: histone H3.2 [Nicotiana attenuata] >XP_019578994.1 PREDICTED: histone H3.2 [Rhinolophus sinicus] >XP_019579013.1 PREDICTED: histone H3.2 [Rhinolophus sinicus] >XP_019579046.1 PREDICTED: histone H3.2 [Rhinolophus sinicus] >XP_019579062.1 PREDICTED: histone H3.2 [Rhinolophus sinicus] >XP_020089911.1 histone H3.2 [Ananas comosus] >XP_020090239.1 histone H3.2 [Ananas comosus] >XP_020111776.1 histone H3.2 [Ananas comosus] >XP_008663191.2 histone H3.2 [Zea mays] >XP_020401458.1 histone H3.2 [Zea mays] >XP_008669428.2 histone H3.2 [Zea mays] >XP_020405898.1 histone H3.2 [Zea mays] >XP_020394886.1 histone H3.2 [Zea mays] >XP_020421876.1 histone H3.2 [Prunus persica] >XP_011088023.2 histone H3.2 [Sesamum indicum] >XP_020867896.1 histone H3.2 [Arabidopsis lyrata subsp. lyrata] >XP_002877046.2 histone H3.2 [Arabidopsis lyrata subsp. lyrata] >XP_020876762.1 histone H3.2 [Arabidopsis lyrata subsp. lyrata] >XP_021300861.1 histone H3.2 [Herrania umbratica] >XP_021275975.1 histone H3.2 [Herrania umbratica] >XP_021278674.1 histone H3.2 [Herrania umbratica] >XP_021311652.1 histone H3.2 [Sorghum bicolor] >XP_021614994.1 histone H3.2 [Manihot esculenta] >XP_021629890.1 histone H3.2 [Manihot esculenta] >XP_021634528.1 histone H3.2 [Manihot esculenta] >XP_021597539.1 histone H3.2 [Manihot esculenta] >XP_021597540.1 histone H3.2 [Manihot esculenta] >XP_021601079.1 histone H3.2 [Manihot esculenta] >XP_021601080.1 histone H3.2 [Manihot esculenta] >XP_021636735.1 histone H3.2 [Hevea brasiliensis] >XP_021666493.1 histone H3.2 [Hevea brasiliensis] >XP_021671981.1 histone H3.2 [Hevea brasiliensis] >XP_021636402.1 histone H3.2 [Hevea brasiliensis] >XP_021639008.1 histone H3.2 [Hevea brasiliensis] >XP_021649553.1 histone H3.2 [Hevea brasiliensis] >XP_021649554.1 histone H3.2 [Hevea brasiliensis] >XP_021660493.1 histone H3.2 [Hevea brasiliensis] >XP_021761018.1 histone H3.2 [Chenopodium quinoa] >XP_021761196.1 histone H3.2 [Chenopodium quinoa] >XP_021771602.1 histone H3.2 [Chenopodium quinoa] >XP_021771603.1 histone H3.2 [Chenopodium quinoa] >XP_021772030.1 histone H3.2 [Chenopodium quinoa] >XP_021773746.1 histone H3.2 [Chenopodium quinoa] >XP_021773747.1 histone H3.2 [Chenopodium quinoa] >XP_021773748.1 histone H3.2 [Chenopodium quinoa] >XP_021719256.1 histone H3.2 [Chenopodium quinoa] >XP_021719258.1 histone H3.2 [Chenopodium quinoa] >XP_021719259.1 histone H3.2 [Chenopodium quinoa] >XP_021728938.1 histone H3.2 [Chenopodium quinoa] >XP_021813959.1 histone H3.2 [Prunus avium] >XP_021827292.1 histone H3.2 [Prunus avium] >XP_021830247.1 histone H3.2 [Prunus avium] >XP_021830879.1 histone H3.2 [Prunus avium] >XP_021853874.1 histone H3.2 [Spinacia oleracea] >XP_021860947.1 histone H3.2 [Spinacia oleracea] >XP_021863052.1 histone H3.2 [Spinacia oleracea] >XP_021843947.1 histone H3.2 [Spinacia oleracea] >XP_021843948.1 histone H3.2 [Spinacia oleracea] >XP_021857796.1 histone H3.2 [Spinacia oleracea] >XP_021894154.1 histone H3.2 [Carica papaya] >XP_021897494.1 histone H3.2 [Carica papaya] >XP_022148796.1 histone H3.2 [Momordica charantia] >XP_022150464.1 histone H3.2 [Momordica charantia] >XP_022552886.1 histone H3.2 [Brassica napus] >XP_022749699.1 histone H3.2 [Durio zibethinus] >XP_022751113.1 histone H3.2 [Durio zibethinus] >XP_022753552.1 histone H3.2 [Durio zibethinus] >XP_022754286.1 histone H3.2 [Durio zibethinus] >XP_022775007.1 histone H3.2 [Durio zibethinus] >XP_022729530.1 histone H3.2 [Durio zibethinus] >XP_022730499.1 histone H3.2 [Durio zibethinus] >XP_022739834.1 histone H3.2 [Durio zibethinus] >XP_022861044.1 histone H3.2 [Olea europaea var. sylvestris] >XP_022884247.1 histone H3.2 [Olea europaea var. sylvestris] >XP_022896559.1 histone H3.2 [Olea europaea var. sylvestris] >XP_022899180.1 histone H3.2 [Olea europaea var. sylvestris] >XP_022899181.1 histone H3.2 [Olea europaea var. sylvestris] >XP_022865383.1 histone H3.2 [Olea europaea var. sylvestris] >XP_022876676.1 histone H3.2 [Olea europaea var. sylvestris] >XP_022879070.1 histone H3.2 [Olea europaea var. sylvestris] >XP_022944489.1 histone H3.2 [Cucurbita moschata] >XP_022958666.1 histone H3.2 [Cucurbita moschata] >XP_022959728.1 histone H3.2 [Cucurbita moschata] >XP_022959793.1 histone H3.2 [Cucurbita moschata] >XP_022961291.1 histone H3.2 [Cucurbita moschata] >XP_022929903.1 histone H3.2 [Cucurbita moschata] >XP_022988234.1 histone H3.2 [Cucurbita maxima] >XP_022992435.1 histone H3.2 [Cucurbita maxima] >XP_022995169.1 histone H3.2 [Cucurbita maxima] >XP_023004688.1 histone H3.2 [Cucurbita maxima] >XP_023005085.1 histone H3.2 [Cucurbita maxima] >XP_023532072.1 histone H3.2 [Cucurbita pepo subsp. pepo] >XP_023511794.1 histone H3.2 [Cucurbita pepo subsp. pepo] >XP_023515063.1 histone H3.2 [Cucurbita pepo subsp. pepo] >XP_023515802.1 histone H3.2 [Cucurbita pepo subsp. pepo] >XP_006301260.2 histone H3.2 [Capsella rubella] >XP_023908460.1 histone H3.2 [Quercus suber] >XP_023908461.1 histone H3.2 [Quercus suber] >XP_023908480.1 histone H3.2 [Quercus suber] >XP_024012002.1 histone H3.2 [Eutrema salsugineum] >XP_024185577.1 histone H3.2 [Rosa chinensis] >XP_024157717.1 histone H3.2 [Rosa chinensis] >XP_024157718.1 histone H3.2 [Rosa chinensis] >XP_024157719.1 histone H3.2 [Rosa chinensis] >XP_024157720.1 histone H3.2 [Rosa chinensis] >XP_024158950.1 histone H3.2 [Rosa chinensis] >XP_024159430.1 histone H3.2 [Rosa chinensis] >XP_024159911.1 histone H3.2 [Rosa chinensis] >XP_024454939.1 histone H3.2 [Populus trichocarpa] >XP_024452900.1 histone H3.2 [Populus trichocarpa] >XP_024922203.1 histone H3.2 [Ziziphus jujuba] >XP_024922204.1 histone H3.2 [Ziziphus jujuba] >XP_024976295.1 histone H3.2 [Cynara cardunculus var. scolymus] >XP_024983405.1 histone H3.2 [Cynara cardunculus var. scolymus] >XP_024996295.1 histone H3.2 [Cynara cardunculus var. scolymus] >XP_025696758.1 histone H3.2 [Arachis hypogaea] >XP_025623480.1 histone H3.2 [Arachis hypogaea] >XP_025638332.1 histone H3.2 [Arachis hypogaea] >XP_025682852.1 histone H3.2 [Arachis hypogaea] >XP_025683864.1 histone H3.2 [Arachis hypogaea] >XP_025806812.1 histone H3.2 [Panicum hallii] >XP_025808898.1 histone H3.2 [Panicum hallii] >XP_025810547.1 histone H3.2 [Panicum hallii] >XP_025811632.1 histone H3.2 [Panicum hallii] >XP_025817322.1 histone H3.2 [Panicum hallii] >XP_025817586.1 histone H3.2 [Panicum hallii] >XP_025823439.1 histone H3.2 [Panicum hallii] >XP_025823554.1 histone H3.2 [Panicum hallii] >P59226.2 RecName: Full=Histone H3.2; AltName: Full=Histone H3.1 >P69246.2 RecName: Full=Histone H3.2 >P69248.2 RecName: Full=Histone H3.2 >Q71T45.3 RecName: Full=Histone H3.2 >Q6LBE3.3 RecName: Full=Histone H3.2 >Q6LCK1.3 RecName: Full=Histone H3.2 >Q76MV0.1 RecName: Full=Histone H3.2 >Q2RAD9.1 RecName: Full=Histone H3.2 >A2Y533.1 RecName: Full=Histone H3.2 >AAF64452.1 histone H3 [Euphorbia esula] >AAK49583.1 histone H3 [Arabidopsis thaliana] >CAA31969.1 unnamed protein product [Oryza sativa] >CAA31970.1 unnamed protein product [Oryza sativa] >AAA33471.1 histone H3 (H3C3) [Zea mays] >AAA33472.1 histone H3 [Zea mays] >AAA33473.1 histone H3 [Zea mays] >AAA66265.1 histone H3 [Zea mays] >AAA33852.1 histone H3 [Petroselinum crispum] >AAA33853.1 histone H3 [Petroselinum crispum] >AAA33854.1 histone H3 [Petroselinum crispum] >AAA32808.1 histone H3 [Arabidopsis thaliana] >AAA32809.1 histone H3 [Arabidopsis thaliana] >CAA59111.1 histone 3 [Zea mays] >AAA79889.1 histone H3 [Arabidopsis thaliana] >AAB67837.1 histone H3 homolog [Brassica napus] >CAA57811.1 Histone H3 [Asparagus officinalis] >AAB18816.1 histone 3 [Oryza sativa Indica Group] >AAC24084.1 Match to histone H3 gene gb|M17131 and gb|M35387 from A. thaliana. ESTs gb|H76511 gb|H76255, gb|AA712452, gb|N65260 and gb|T42306 come from this gene [Arabidopsis thaliana] >BAA81840.1 histone H3 [Oryza sativa Japonica Group] >BAA81841.1 histone H3 [Oryza sativa Japonica Group] >CAB89403.1 histone H3-like protein [Arabidopsis thaliana] >CAB89404.1 histone H3-like protein [Arabidopsis thaliana] >BAA95712.1 histone H3-like protein [Arabidopsis thaliana] >BAB11558.1 histone H3 [Arabidopsis thaliana] >AAK59851.1 AT3g27360/K1G2_6 [Arabidopsis thaliana] >AAK64008.1 AT5g65360/MNA5_9 [Arabidopsis thaliana] >AAL76132.1 AT3g27360/K1G2_6 [Arabidopsis thaliana] >AAL87394.1 AT5g65360/MNA5_9 [Arabidopsis thaliana] >AAM60903.1 histone H3-like protein [Arabidopsis thaliana] >BAC01212.1 histone H3 [Oryza sativa Japonica Group] >AAM95675.1 histone H3 [Orobanche cernua var. cumana] >BAC41835.1 putative histone H3 [Arabidopsis thaliana] >BAC53942.1 H3 histone [Nicotiana tabacum] >AAO23616.1 At5g10400 [Arabidopsis thaliana] >AAO24594.1 At1g09200 [Arabidopsis thaliana] >AAO64207.1 putative histone H3 [Arabidopsis thaliana] >AAP04053.1 putative histone H3 [Arabidopsis thaliana] >CAE02924.1 OSJNBb0108J11.17 [Oryza sativa Japonica Group] >AAT07615.1 putative histone H3 [Oryza sativa Japonica Group] >BAD46448.1 histone H3 [Oryza sativa Japonica Group] >BAD46453.1 histone H3 [Oryza sativa Japonica Group] >BAD46454.1 histone H3 [Oryza sativa Japonica Group] >AAX92719.1 histone H3 - maize [Oryza sativa Japonica Group] >AAZ66939.1 117M18_20 [Brassica rapa] >ABA91537.2 Histone H3, putative, expressed [Oryza sativa Japonica Group] >BAF00340.1 histone H3 like protein [Arabidopsis thaliana] >BAE99603.1 histone H3 like protein [Arabidopsis thaliana] >BAE99643.1 histone H3 like protein [Arabidopsis thaliana] >BAF06818.1 Os01g0866200 [Oryza sativa Japonica Group] >BAF14690.1 Os04g0419600 [Oryza sativa Japonica Group] >BAF17574.1 Os05g0438700 [Oryza sativa Japonica Group] >BAF18791.1 Os06g0160100 [Oryza sativa Japonica Group] >BAF27636.1 Os11g0155900 [Oryza sativa Japonica Group] >ABK21761.1 unknown [Picea sitchensis] >ABK25492.1 unknown [Picea sitchensis] >ABK92858.1 unknown [Populus trichocarpa] >ABK93905.1 unknown [Populus trichocarpa] >ABK93950.1 unknown [Populus trichocarpa] >ABK95888.1 unknown [Populus trichocarpa] >EAY80005.1 hypothetical protein OsI_35174 [Oryza sativa Indica Group] >EAY98193.1 hypothetical protein OsI_20106 [Oryza sativa Indica Group] >EAY99776.1 hypothetical protein OsI_21763 [Oryza sativa Indica Group] >EAY99779.1 hypothetical protein OsI_21766 [Oryza sativa Indica Group] >EAZ14271.1 hypothetical protein OsJ_04197 [Oryza sativa Japonica Group] >EAZ30723.1 hypothetical protein OsJ_14783 [Oryza sativa Japonica Group] >EAZ35903.1 hypothetical protein OsJ_20204 [Oryza sativa Japonica Group] >CAN73758.1 hypothetical protein VITISV_031197 [Vitis vinifera] >CAN80002.1 hypothetical protein VITISV_043973 [Vitis vinifera] >CAN83843.1 hypothetical protein VITISV_044079 [Vitis vinifera] >CAN80880.1 hypothetical protein VITISV_018649 [Vitis vinifera] >CAN83194.1 hypothetical protein VITISV_010341 [Vitis vinifera] >ABS11143.1 histone H3 [Nicotiana benthamiana] >BAF76800.1 histone H3.1 [Nicotiana tabacum] >ACF79612.1 unknown [Zea mays] >ACF82232.1 unknown [Zea mays] >ACF86247.1 unknown [Zea mays] >ACF88431.1 unknown [Zea mays] >ACG25137.1 histone H3 [Zea mays] >ACG27345.1 histone H3 [Zea mays] >ACG30057.1 histone H3 [Zea mays] >ACG30474.1 histone H3 [Zea mays] >ACG30701.1 histone H3 [Zea mays] >ACG30707.1 histone H3 [Zea mays] >ACG30791.1 histone H3 [Zea mays] >ACG30950.1 histone H3 [Zea mays] >ACG31934.1 histone H3 [Zea mays] >ACG36961.1 histone H3 [Zea mays] >ACG39635.1 histone H3 [Zea mays] >ACG40073.1 histone H3 [Zea mays] >ACG40983.1 histone H3 [Zea mays] >ACG47284.1 histone H3 [Zea mays] >ACG70966.1 histone H3 [Ziziphus jujuba] >BAH00243.1 unnamed protein product [Oryza sativa Japonica Group] >EEC80059.1 hypothetical protein OsI_21765 [Oryza sativa Indica Group] >EEE51672.1 hypothetical protein OsJ_33018 [Oryza sativa Japonica Group] >EEF28815.1 histone h3, putative [Ricinus communis] >EEF28818.1 histone h3, putative [Ricinus communis] >EEF28820.1 histone h3, putative [Ricinus communis] >EEF28821.1 histone h3, putative [Ricinus communis] >EEF37755.1 histone h3, putative [Ricinus communis] >EEF39802.1 histone h3, putative [Ricinus communis] >ACN33923.1 unknown [Zea mays] >ACR37182.1 unknown [Zea mays] >ACR37485.1 unknown [Zea mays] >ACR37603.1 unknown [Zea mays] >ACR37986.1 unknown [Zea mays] >ACR38054.1 unknown [Zea mays] >EER87889.1 hypothetical protein SORBI_3010G047200 [Sorghum bicolor] >EER89236.1 hypothetical protein SORBI_3010G047100 [Sorghum bicolor] >EES05210.1 hypothetical protein SORBI_3004G170500 [Sorghum bicolor] >EES10786.1 hypothetical protein SORBI_3006G076400 [Sorghum bicolor] >EES12174.1 hypothetical protein SORBI_3006G081800 [Sorghum bicolor] >BAH93339.1 Os06g0159501 [Oryza sativa Japonica Group] >BAH93341.1 Os06g0160001 [Oryza sativa Japonica Group] >ADC54261.1 histone H3 [Oryza sativa Japonica Group] >ADE76159.1 unknown [Picea sitchensis] >ADE76345.1 unknown [Picea sitchensis] >ADE76464.1 unknown [Picea sitchensis] >ADE77414.1 unknown [Picea sitchensis] >EFH49713.1 histone H3 [Arabidopsis lyrata subsp. lyrata] >EFH49714.1 histone H3 [Arabidopsis lyrata subsp. lyrata] >EFH53304.1 histone H3 [Arabidopsis lyrata subsp. lyrata] >EFH68749.1 histone H3 [Arabidopsis lyrata subsp. lyrata] >EFH70907.1 histone H3 [Arabidopsis lyrata subsp. lyrata] >ADR30794.1 histone H3.1 [Hevea brasiliensis] >BAJ53177.1 JHL18I08.11 [Jatropha curcas] >AED91535.1 Histone superfamily protein [Arabidopsis thaliana] >AED91536.1 Histone superfamily protein [Arabidopsis thaliana] >AED98043.1 Histone superfamily protein [Arabidopsis thaliana] >AEE28413.1 Histone superfamily protein [Arabidopsis thaliana] >AEE77308.1 Histone superfamily protein [Arabidopsis thaliana] >CCD74495.1 histone H3 [Arabidopsis halleri subsp. halleri] >EOA22021.1 hypothetical protein CARUB_v10002544mg [Capsella rubella] >EOA22699.1 hypothetical protein CARUB_v10003405mg [Capsella rubella] >EOA25431.1 hypothetical protein CARUB_v10018763mg [Capsella rubella] >EOA37535.1 hypothetical protein CARUB_v10011755mg [Capsella rubella] >EOX91995.1 Histone superfamily protein [Theobroma cacao] >EOY32556.1 Histone superfamily protein [Theobroma cacao] >EPS69903.1 hypothetical protein M569_04854 [Genlisea aurea] >ERM95023.1 hypothetical protein AMTR_s00009p00240080 [Amborella trichopoda] >ERN16002.1 hypothetical protein AMTR_s00030p00044250 [Amborella trichopoda] >ESQ31330.1 hypothetical protein EUTSA_v10005111mg [Eutrema salsugineum] >ESQ31480.1 hypothetical protein EUTSA_v10005114mg [Eutrema salsugineum] >ESQ38364.1 hypothetical protein EUTSA_v10029057mg [Eutrema salsugineum] >ESQ40985.1 hypothetical protein EUTSA_v10014986mg [Eutrema salsugineum] >ESQ40987.1 hypothetical protein EUTSA_v10014985mg [Eutrema salsugineum] >ESR39550.1 hypothetical protein CICLE_v10026742mg [Citrus clementina] >ESR59247.1 hypothetical protein CICLE_v10017132mg [Citrus clementina] >ESR59252.1 hypothetical protein CICLE_v10017131mg [Citrus clementina] >ESR59267.1 hypothetical protein CICLE_v10017133mg [Citrus clementina] >EXB28981.1 Histone [Morus notabilis] >EXB28982.1 Histone [Morus notabilis] >EXB48389.1 Histone [Morus notabilis] >EXB48391.1 Histone [Morus notabilis] >EXC30548.1 Histone [Morus notabilis] >EYU18019.1 hypothetical protein MIMGU_mgv1a016053mg [Erythranthe guttata] >EYU18357.1 hypothetical protein MIMGU_mgv1a016039mg [Erythranthe guttata] >EYU26936.1 hypothetical protein MIMGU_mgv1a016046mg [Erythranthe guttata] >EYU39090.1 hypothetical protein MIMGU_mgv1a016037mg [Erythranthe guttata] >EYU43364.1 hypothetical protein MIMGU_mgv1a024982mg [Erythranthe guttata] >EYU46298.1 hypothetical protein MIMGU_mgv1a016044mg [Erythranthe guttata] >KCW52687.1 hypothetical protein EUGRSUZ_J02055 [Eucalyptus grandis] >KCW87138.1 hypothetical protein EUGRSUZ_B03665 [Eucalyptus grandis] >KDO60645.1 hypothetical protein CISIN_1g032664mg [Citrus sinensis] >KDO64858.1 hypothetical protein CISIN_1g032661mg [Citrus sinensis] >KDO64866.1 hypothetical protein CISIN_1g032673mg [Citrus sinensis] >KDO64873.1 hypothetical protein CISIN_1g032676mg [Citrus sinensis] >KDP20190.1 hypothetical protein JCGZ_07910 [Jatropha curcas] >KDP21024.1 hypothetical protein JCGZ_21495 [Jatropha curcas] >CDP11387.1 unnamed protein product [Coffea canephora] >CDP07721.1 unnamed protein product [Coffea canephora] >CDP07722.1 unnamed protein product [Coffea canephora] >KFK25331.1 hypothetical protein AALP_AA8G099000 [Arabis alpina] >KFK25332.1 hypothetical protein AALP_AA8G099100 [Arabis alpina] >KFK28215.1 hypothetical protein AALP_AA8G487700 [Arabis alpina] >KFK28217.1 hypothetical protein AALP_AA8G487900 [Arabis alpina] >KFK43216.1 hypothetical protein AALP_AA1G095700 [Arabis alpina] >KGN54155.1 histone H3 [Cucumis sativus] >AIZ04726.1 histone 3 [Elettaria cardamomum] >KJB21399.1 hypothetical protein B456_004G040400 [Gossypium raimondii] >KJB21400.1 hypothetical protein B456_004G040400 [Gossypium raimondii] >KJB27088.1 hypothetical protein B456_004G277200 [Gossypium raimondii] >KJB54045.1 hypothetical protein B456_009G018200 [Gossypium raimondii] >KJB70057.1 hypothetical protein B456_011G056400 [Gossypium raimondii] >KJB70058.1 hypothetical protein B456_011G056400 [Gossypium raimondii] >KJB70059.1 hypothetical protein B456_011G056500 [Gossypium raimondii] >KJB83503.1 hypothetical protein B456_013G250500 [Gossypium raimondii] >KMT13094.1 hypothetical protein BVRB_4g086350 [Beta vulgaris subsp. vulgaris] >KMT13099.1 hypothetical protein BVRB_4g086410 [Beta vulgaris subsp. vulgaris] >KMT13100.1 hypothetical protein BVRB_4g086420 [Beta vulgaris subsp. vulgaris] >KMT14440.1 hypothetical protein BVRB_4g072160 [Beta vulgaris subsp. vulgaris] >KMT14442.1 hypothetical protein BVRB_4g072180 [Beta vulgaris subsp. vulgaris] >KNA08063.1 hypothetical protein SOVF_166110 [Spinacia oleracea] >KNA10491.1 hypothetical protein SOVF_143550 [Spinacia oleracea] >KNA19691.1 hypothetical protein SOVF_059220 [Spinacia oleracea] >KNA24957.1 hypothetical protein SOVF_010940 [Spinacia oleracea] >KNA25425.1 hypothetical protein SOVF_005400 [Spinacia oleracea] >KNA26076.1 hypothetical protein SOVF_000590 [Spinacia oleracea] >BAS96275.1 Os06g0160001 [Oryza sativa Japonica Group] >BAT12754.1 Os11g0155900 [Oryza sativa Japonica Group] >ALY11031.1 histone h3 [Ziziphus jujuba] >KVH91569.1 Histone core [Cynara cardunculus var. scolymus] >KVI09448.1 Histone core [Cynara cardunculus var. scolymus] >KZN09387.1 hypothetical protein DCAR_002043 [Daucus carota subsp. sativus] >KZV18472.1 hypothetical protein F511_18040 [Dorcoceras hygrometricum] >KZV44364.1 hypothetical protein F511_26446 [Dorcoceras hygrometricum] >KZV49603.1 hypothetical protein F511_23983 [Dorcoceras hygrometricum] >KZV57557.1 hypothetical protein F511_03017 [Dorcoceras hygrometricum] >OAO92781.1 hypothetical protein AXX17_AT5G10060 [Arabidopsis thaliana] >OAO93749.1 hypothetical protein AXX17_AT5G65170 [Arabidopsis thaliana] >OAO95383.1 hypothetical protein AXX17_AT5G10050 [Arabidopsis thaliana] >OAP05420.1 hypothetical protein AXX17_AT3G29860 [Arabidopsis thaliana] >OAP16403.1 hypothetical protein AXX17_AT1G09060 [Arabidopsis thaliana] >OAY22690.1 hypothetical protein MANES_18G018500 [Manihot esculenta] >OAY22691.1 hypothetical protein MANES_18G018600 [Manihot esculenta] >OAY26256.1 hypothetical protein MANES_16G033300 [Manihot esculenta] >OAY26257.1 hypothetical protein MANES_16G033400 [Manihot esculenta] >OAY30213.1 hypothetical protein MANES_14G013600 [Manihot esculenta] >OAY33453.1 hypothetical protein MANES_13G097500 [Manihot esculenta] >OAY33454.1 hypothetical protein MANES_13G097600 [Manihot esculenta] >OAY35771.1 hypothetical protein MANES_12G129100 [Manihot esculenta] >OAY48573.1 hypothetical protein MANES_06G168000 [Manihot esculenta] >OAY76534.1 histone H3.2 [Ananas comosus] >OAY84850.1 histone H3.2 [Ananas comosus] >OEL28075.1 histone H3.2 [Dichanthelium oligosanthes] >OEL37560.1 histone H3.2 [Dichanthelium oligosanthes] >OIT01611.1 histone h3.2 [Nicotiana attenuata] >OIT06005.1 histone h3.2 [Nicotiana attenuata] >OIT19610.1 histone h3.2 [Nicotiana attenuata] >OIT29440.1 histone h3.2 [Nicotiana attenuata] >OIT33820.1 histone h3.2 [Nicotiana attenuata] >OIT33823.1 histone h3.2 [Nicotiana attenuata] >OIT34440.1 histone h3.2 [Nicotiana attenuata] >OIT35721.1 histone h3.2 [Nicotiana attenuata] >OMO56171.1 histone H3 [Corchorus capsularis] >OMO61394.1 histone H3 [Corchorus capsularis] >OMO68602.1 histone H3 [Corchorus capsularis] >OMO73020.1 histone H3 [Corchorus olitorius] >OMO75026.1 histone H3 [Corchorus olitorius] >OMO78124.1 histone H3 [Corchorus olitorius] >OMO79345.1 histone H3 [Corchorus capsularis] >OMP07230.1 histone H3 [Corchorus olitorius] >ONH99186.1 hypothetical protein PRUPE_6G016200 [Prunus persica] >ONH99252.1 hypothetical protein PRUPE_6G021100 [Prunus persica] >ONH99260.1 hypothetical protein PRUPE_6G021700 [Prunus persica] >ONI10569.1 hypothetical protein PRUPE_4G054300 [Prunus persica] >AQK43642.1 Histone H3.2 [Zea mays] >AQK43643.1 Histone H3.2 [Zea mays] >AQK43644.1 Histone H3.2 [Zea mays] >AQK43690.1 Histone H3.2 [Zea mays] >ONM17576.1 Histone H3.2 [Zea mays] >ONM17641.1 Histone H3.2 [Zea mays] >ONM29953.1 Histone H3.2 [Zea mays] >ONM33459.1 Histone H3.2 [Zea mays] >AQK52929.1 Histone H3.2 [Zea mays] >AQK80506.1 Histone H3-like 5 [Zea mays] >AQL01931.1 Histone H3.2 [Zea mays] >OQU85091.1 hypothetical protein SORBI_3004G170500 [Sorghum bicolor] >BAX24621.1 Histone H3.2 [Oryza sativa Indica Group] >BAX24623.1 Histone H3.2 [Oryza sativa Indica Group] >BAX24624.1 Histone H3.2 [Oryza sativa Indica Group] >BAX24935.1 histone H3 [Oryza punctata] >BAX24937.1 histone H3 [Oryza punctata] >BAX24938.1 histone H3 [Oryza punctata] >BAX25133.1 Histone H3.2 [Oryza brachyantha] >BAX25134.1 Histone H3.2 [Oryza brachyantha] >OVA00004.1 histone H3 [Macleaya cordata] >OVA04815.1 histone H3 [Macleaya cordata] >OWM68807.1 hypothetical protein CDL15_Pgr024994 [Punica granatum] >OWM69218.1 hypothetical protein CDL15_Pgr025405 [Punica granatum] >OWM76391.1 hypothetical protein CDL15_Pgr028261 [Punica granatum] >PAN06389.1 hypothetical protein PAHAL_1G260800 [Panicum hallii] >PAN32327.1 hypothetical protein PAHAL_5G078300 [Panicum hallii] >PAN38095.1 hypothetical protein PAHAL_7G145800 [Panicum hallii] >PAN38097.1 hypothetical protein PAHAL_7G146800 [Panicum hallii] >PHT55884.1 histone H3.2 [Capsicum baccatum] >PHT59866.1 histone H3.2 [Capsicum baccatum] >PHT60180.1 histone H3.2 [Capsicum baccatum] >PHT60183.1 histone H3.2 [Capsicum baccatum] >PHT60202.1 histone H3.2 [Capsicum baccatum] >PHT89981.1 histone H3.2 [Capsicum annuum] >PHT93565.1 histone H3.2 [Capsicum annuum] >PHT94495.1 histone H3.2 [Capsicum annuum] >PHT94599.1 histone H3.2 [Capsicum annuum] >PHT94617.1 histone H3.2 [Capsicum annuum] >PHT94998.1 histone H3.2 [Capsicum annuum] >PHU26249.1 histone H3.2 [Capsicum chinense] >PHU30145.1 histone H3.2 [Capsicum chinense] >PHU30150.1 histone H3.2 [Capsicum chinense] >PHU30441.1 histone H3.2 [Capsicum chinense] >PHU30445.1 histone H3.2 [Capsicum chinense] >PHU30655.1 histone H3.2 [Capsicum chinense] >PIA35068.1 hypothetical protein AQUCO_03600018v1 [Aquilegia coerulea] >PIA35088.1 hypothetical protein AQUCO_03600030v1 [Aquilegia coerulea] >PIA54070.1 hypothetical protein AQUCO_00900562v1 [Aquilegia coerulea] >PIN00176.1 Histones H3 and H4 [Handroanthus impetiginosus] >PIN17664.1 Histones H3 and H4 [Handroanthus impetiginosus] >PIN18957.1 Histones H3 and H4 [Handroanthus impetiginosus] >PIN23817.1 Histones H3 and H4 [Handroanthus impetiginosus] >PKA58246.1 Histone H3.2 [Apostasia shenzhenica] >PKA58336.1 Histone H3.2 [Apostasia shenzhenica] >PKA58338.1 Histone H3.2 [Apostasia shenzhenica] >PKI36434.1 hypothetical protein CRG98_043216 [Punica granatum] >PKI37978.1 hypothetical protein CRG98_041633 [Punica granatum] >PKI58611.1 hypothetical protein CRG98_021000 [Punica granatum] >PKI60221.1 hypothetical protein CRG98_019409 [Punica granatum] >PKI72834.1 hypothetical protein CRG98_006759 [Punica granatum] >GAY41411.1 hypothetical protein CUMW_059240 [Citrus unshiu] >GAY41424.1 hypothetical protein CUMW_059340 [Citrus unshiu] >GAY41431.1 hypothetical protein CUMW_059400 [Citrus unshiu] >PNT03936.1 hypothetical protein POPTR_014G096900v3 [Populus trichocarpa] >PNT46712.1 hypothetical protein POPTR_003G207700v3 [Populus trichocarpa] >PNT46737.1 hypothetical protein POPTR_003G210100v3 [Populus trichocarpa] >PNT47495.1 hypothetical protein POPTR_002G028800v3 [Populus trichocarpa] >PNT52171.1 hypothetical protein POPTR_001G016900v3 [Populus trichocarpa] >POF05507.1 histone H3.2 [Quercus suber] >POF15746.1 histone H3.2 [Quercus suber] >POF15748.1 histone H3.2 [Quercus suber] >POF15749.1 histone H3.2 [Quercus suber] >PON52626.1 histone H3/CENP-A [Parasponia andersonii] >PON57118.1 histone H3/CENP-A [Trema orientalis] >PON69749.1 histone H3/CENP-A [Parasponia andersonii] >PON77941.1 histone H3/CENP-A [Parasponia andersonii] >PON89236.1 histone H3/CENP-A [Trema orientalis] >PPD67719.1 hypothetical protein GOBAR_DD35399 [Gossypium barbadense] >PPD75573.1 hypothetical protein GOBAR_DD27502 [Gossypium barbadense] >PPD83470.1 hypothetical protein GOBAR_DD19595 [Gossypium barbadense] >PPD84531.1 hypothetical protein GOBAR_DD18540 [Gossypium barbadense] >PPD86084.1 hypothetical protein GOBAR_DD16981 [Gossypium barbadense] >PPD86085.1 hypothetical protein GOBAR_DD16982 [Gossypium barbadense] >PPD86086.1 hypothetical protein GOBAR_DD16983 [Gossypium barbadense] >PPE01028.1 hypothetical protein GOBAR_DD01992 [Gossypium barbadense] >PPR88551.1 hypothetical protein GOBAR_AA32127 [Gossypium barbadense] >PPR88727.1 hypothetical protein GOBAR_AA31968 [Gossypium barbadense] >PPR88728.1 hypothetical protein GOBAR_AA31969 [Gossypium barbadense] >PPR90211.1 hypothetical protein GOBAR_AA30467 [Gossypium barbadense] >PPR94006.1 hypothetical protein GOBAR_AA26667 [Gossypium barbadense] >PPS13282.1 hypothetical protein GOBAR_AA07369 [Gossypium barbadense] >PPS15042.1 hypothetical protein GOBAR_AA05521 [Gossypium barbadense] >PPS15043.1 hypothetical protein GOBAR_AA05522 [Gossypium barbadense] >PPS15044.1 hypothetical protein GOBAR_AA05523 [Gossypium barbadense] >PPS15045.1 hypothetical protein GOBAR_AA05524 [Gossypium barbadense] >PPS15046.1 hypothetical protein GOBAR_AA05525 [Gossypium barbadense] >PQM33280.1 hypothetical protein Pyn_34678 [Prunus yedoensis var. nudiflora] >PQQ00046.1 hypothetical protein Pyn_37458 [Prunus yedoensis var. nudiflora] >PQQ02061.1 hypothetical protein Pyn_29517 [Prunus yedoensis var. nudiflora] >PQQ02070.1 hypothetical protein Pyn_29526 [Prunus yedoensis var. nudiflora] >PQQ12859.1 hypothetical protein Pyn_36769 [Prunus yedoensis var. nudiflora] >PRQ29035.1 putative transcription factor Hap3/NF-YB family [Rosa chinensis] >PRQ33958.1 putative transcription factor Hap3/NF-YB family [Rosa chinensis] >PRQ34585.1 putative transcription factor Hap3/NF-YB family [Rosa chinensis] >PRQ35225.1 putative transcription factor Hap3/NF-YB family [Rosa chinensis] >PRQ35229.1 putative transcription factor Hap3/NF-YB family [Rosa chinensis] >PRQ35234.1 putative transcription factor Hap3/NF-YB family [Rosa chinensis] >PRQ35241.1 putative transcription factor Hap3/NF-YB family [Rosa chinensis] >PRQ52810.1 putative transcription factor Hap3/NF-YB family [Rosa chinensis] >PSR95393.1 histone H3.2 like [Actinidia chinensis var. chinensis] >PSR98608.1 histone H3.2 like [Actinidia chinensis var. chinensis] >PSS04816.1 histone H3.2 like [Actinidia chinensis var. chinensis] >PSS10206.1 histone H3.2 like [Actinidia chinensis var. chinensis] >PSS11986.1 histone H3.2 like [Actinidia chinensis var. chinensis] >PSS26453.1 histone H3.2 like [Actinidia chinensis var. chinensis] >PUZ47123.1 hypothetical protein GQ55_7G138000 [Panicum hallii var. hallii] >PUZ47125.1 hypothetical protein GQ55_7G138300 [Panicum hallii var. hallii] >PUZ53805.1 hypothetical protein GQ55_5G079300 [Panicum hallii var. hallii] >PUZ58113.1 hypothetical protein GQ55_5G483500 [Panicum hallii var. hallii] >PUZ62099.1 hypothetical protein GQ55_4G330700 [Panicum hallii var. hallii] >PUZ65791.1 hypothetical protein GQ55_3G253100 [Panicum hallii var. hallii] >PUZ76008.1 hypothetical protein GQ55_1G256600 [Panicum hallii var. hallii] >PAN32332.2 hypothetical protein PAHAL_5G478600 [Panicum hallii] >PVH62298.1 hypothetical protein PAHAL_3G262300 [Panicum hallii] >PWZ04363.1 histone H3.2 [Zea mays] >PWZ04393.1 histone H3.2 [Zea mays] >PWZ07110.1 histone H3.2 [Zea mays] >PWZ17178.1 histone H3.2 [Zea mays] >PWZ20351.1 histone H3.2 [Zea mays] >PWZ25653.1 histone H3.2 [Zea mays] >PWZ33191.1 histone H3.2 [Zea mays] >PWZ34388.1 histone H3.2 [Zea mays] >PWZ37157.1 histone H3.2 [Zea mays] >PWZ37159.1 histone H3.2 [Zea mays] >PWZ43992.1 histone H3.2 [Zea mays] >PWZ44779.1 histone H3.2 [Zea mays] >RCV17534.1 hypothetical protein SETIT_3G227400v2 [Setaria italica] >RCV20558.1 hypothetical protein SETIT_4G066000v2 [Setaria italica] >RCV20560.1 hypothetical protein SETIT_4G066200v2 [Setaria italica] >RCV33607.1 hypothetical protein SETIT_7G095500v2 [Setaria italica] >prf||1303352A histone H3 >prf||1314298B histone H3) HSP 1 Score: 253.4 bits (646), Expect = 4.2e-64 Identity = 136/136 (100.00%), Postives = 136/136 (100.00%), Query Frame = 0
BLAST of Carg04914 vs. NCBI nr
Match: EOA34158.1 (hypothetical protein CARUB_v10021660mg, partial [Capsella rubella]) HSP 1 Score: 253.4 bits (646), Expect = 4.2e-64 Identity = 136/136 (100.00%), Postives = 136/136 (100.00%), Query Frame = 0
BLAST of Carg04914 vs. NCBI nr
Match: EOY31042.1 (Histone superfamily protein [Theobroma cacao]) HSP 1 Score: 253.4 bits (646), Expect = 4.2e-64 Identity = 136/136 (100.00%), Postives = 136/136 (100.00%), Query Frame = 0
BLAST of Carg04914 vs. TAIR10
Match: AT1G09200.1 (Histone superfamily protein) HSP 1 Score: 253.4 bits (646), Expect = 7.7e-68 Identity = 136/136 (100.00%), Postives = 136/136 (100.00%), Query Frame = 0
BLAST of Carg04914 vs. TAIR10
Match: AT3G27360.1 (Histone superfamily protein) HSP 1 Score: 253.4 bits (646), Expect = 7.7e-68 Identity = 136/136 (100.00%), Postives = 136/136 (100.00%), Query Frame = 0
BLAST of Carg04914 vs. TAIR10
Match: AT5G10390.1 (Histone superfamily protein) HSP 1 Score: 253.4 bits (646), Expect = 7.7e-68 Identity = 136/136 (100.00%), Postives = 136/136 (100.00%), Query Frame = 0
BLAST of Carg04914 vs. TAIR10
Match: AT5G10400.1 (Histone superfamily protein) HSP 1 Score: 253.4 bits (646), Expect = 7.7e-68 Identity = 136/136 (100.00%), Postives = 136/136 (100.00%), Query Frame = 0
BLAST of Carg04914 vs. TAIR10
Match: AT5G65360.1 (Histone superfamily protein) HSP 1 Score: 253.4 bits (646), Expect = 7.7e-68 Identity = 136/136 (100.00%), Postives = 136/136 (100.00%), Query Frame = 0
BLAST of Carg04914 vs. Swiss-Prot
Match: sp|P59226|H32_ARATH (Histone H3.2 OS=Arabidopsis thaliana OX=3702 GN=HTR2 PE=1 SV=2) HSP 1 Score: 253.4 bits (646), Expect = 1.4e-66 Identity = 136/136 (100.00%), Postives = 136/136 (100.00%), Query Frame = 0
BLAST of Carg04914 vs. Swiss-Prot
Match: sp|Q6LBE3|H32_ASPOF (Histone H3.2 OS=Asparagus officinalis OX=4686 PE=2 SV=3) HSP 1 Score: 253.4 bits (646), Expect = 1.4e-66 Identity = 136/136 (100.00%), Postives = 136/136 (100.00%), Query Frame = 0
BLAST of Carg04914 vs. Swiss-Prot
Match: sp|Q6LCK1|H32_BRANA (Histone H3.2 OS=Brassica napus OX=3708 PE=2 SV=3) HSP 1 Score: 253.4 bits (646), Expect = 1.4e-66 Identity = 136/136 (100.00%), Postives = 136/136 (100.00%), Query Frame = 0
BLAST of Carg04914 vs. Swiss-Prot
Match: sp|Q71T45|H32_EUPES (Histone H3.2 OS=Euphorbia esula OX=3993 GN=H3 PE=2 SV=3) HSP 1 Score: 253.4 bits (646), Expect = 1.4e-66 Identity = 136/136 (100.00%), Postives = 136/136 (100.00%), Query Frame = 0
BLAST of Carg04914 vs. Swiss-Prot
Match: sp|P69246|H32_MAIZE (Histone H3.2 OS=Zea mays OX=4577 GN=H3C2 PE=1 SV=2) HSP 1 Score: 253.4 bits (646), Expect = 1.4e-66 Identity = 136/136 (100.00%), Postives = 136/136 (100.00%), Query Frame = 0
BLAST of Carg04914 vs. TrEMBL
Match: tr|A0A2P5C7U2|A0A2P5C7U2_9ROSA (Histone H3 OS=Trema orientalis OX=63057 GN=TorRG33x02_150990 PE=3 SV=1) HSP 1 Score: 253.4 bits (646), Expect = 2.8e-64 Identity = 136/136 (100.00%), Postives = 136/136 (100.00%), Query Frame = 0
BLAST of Carg04914 vs. TrEMBL
Match: tr|A0A2T7ED86|A0A2T7ED86_9POAL (Uncharacterized protein OS=Panicum hallii var. hallii OX=1504633 GN=GQ55_1G256600 PE=4 SV=1) HSP 1 Score: 253.4 bits (646), Expect = 2.8e-64 Identity = 136/136 (100.00%), Postives = 136/136 (100.00%), Query Frame = 0
BLAST of Carg04914 vs. TrEMBL
Match: tr|A0A1U8F6I8|A0A1U8F6I8_CAPAN (Histone H3 OS=Capsicum annuum OX=4072 GN=T459_01447 PE=3 SV=1) HSP 1 Score: 253.4 bits (646), Expect = 2.8e-64 Identity = 136/136 (100.00%), Postives = 136/136 (100.00%), Query Frame = 0
BLAST of Carg04914 vs. TrEMBL
Match: tr|A0A1U8FM37|A0A1U8FM37_CAPAN (Histone H3 OS=Capsicum annuum OX=4072 GN=LOC107856945 PE=3 SV=1) HSP 1 Score: 253.4 bits (646), Expect = 2.8e-64 Identity = 136/136 (100.00%), Postives = 136/136 (100.00%), Query Frame = 0
BLAST of Carg04914 vs. TrEMBL
Match: tr|M1D4I9|M1D4I9_SOLTU (Histone H3 OS=Solanum tuberosum OX=4113 GN=102601089 PE=3 SV=1) HSP 1 Score: 253.4 bits (646), Expect = 2.8e-64 Identity = 136/136 (100.00%), Postives = 136/136 (100.00%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of silver-seed gourd
Date Performed: 2019-03-07
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|