Carg02337 (gene) Silver-seed gourd
The following sequences are available for this feature:
Legend: polypeptideCDSexon Hold the cursor over a type above to highlight its positions in the sequence below.ATGATGAAGCTCCGGTCTAAGAGGTTCTGCACAGCCTCCACTTTCAGGCTTCCAAGCTTCGTCACCCGCTGCAACAAGAAGATCAAAGTCGCCGACGACCACCACAACGACATCGTCCCCCTGTCCGAAATCAAGTGGGAGCTCCGCCCCGGTGGCATGCTTGTCCAGAGAAGAGAGATCCCCGCCCCACCCACTTTCACCCGAGATCAAACTATCACGGTTAGAGTCTCAACCGTCTCCCAATCCCACGACATTTCAATCCAACCGATCTCAACTTTTGGTAAGTCCAGTTAAAATATCAAATATAAACTGTCTGGTCTCTACTATAAATACTCCTTAACTCATAGTGTCTTGTAATCTCTTTTTTATTGTTTTTAATAAAGAGTACGAGTGTTTCAGGGGAATTGAAGATGATTCTATCAATGGTGACGGGTTTGGAAGCAAGAGAGCAAAGATTGCTATTCAAAGGGAAGGAAAGAGATGACTGTGAGTATCTACACATGGTGGGAGTAGGAGACAAAGACAAGGTTCTTCTGCTTGAAGATCCAGCCATCACAGAAAGGAAGCTTCATGGCTTGGCAGCATCCCAACCAATTAGTGTATAA ATGATGAAGCTCCGGTCTAAGAGGTTCTGCACAGCCTCCACTTTCAGGCTTCCAAGCTTCGTCACCCGCTGCAACAAGAAGATCAAAGTCGCCGACGACCACCACAACGACATCGTCCCCCTGTCCGAAATCAAGTGGGAGCTCCGCCCCGGTGGCATGCTTGTCCAGAGAAGAGAGATCCCCGCCCCACCCACTTTCACCCGAGATCAAACTATCACGGTTAGAGTCTCAACCGTCTCCCAATCCCACGACATTTCAATCCAACCGATCTCAACTTTTGGGAAGGAAAGAGATGACTGTGAGTATCTACACATGGTGGGAGTAGGAGACAAAGACAAGGTTCTTCTGCTTGAAGATCCAGCCATCACAGAAAGGAAGCTTCATGGCTTGGCAGCATCCCAACCAATTAGTGTATAA ATGATGAAGCTCCGGTCTAAGAGGTTCTGCACAGCCTCCACTTTCAGGCTTCCAAGCTTCGTCACCCGCTGCAACAAGAAGATCAAAGTCGCCGACGACCACCACAACGACATCGTCCCCCTGTCCGAAATCAAGTGGGAGCTCCGCCCCGGTGGCATGCTTGTCCAGAGAAGAGAGATCCCCGCCCCACCCACTTTCACCCGAGATCAAACTATCACGGTTAGAGTCTCAACCGTCTCCCAATCCCACGACATTTCAATCCAACCGATCTCAACTTTTGGGAAGGAAAGAGATGACTGTGAGTATCTACACATGGTGGGAGTAGGAGACAAAGACAAGGTTCTTCTGCTTGAAGATCCAGCCATCACAGAAAGGAAGCTTCATGGCTTGGCAGCATCCCAACCAATTAGTGTATAA MMKLRSKRFCTASTFRLPSFVTRCNKKIKVADDHHNDIVPLSEIKWELRPGGMLVQRREIPAPPTFTRDQTITVRVSTVSQSHDISIQPISTFGKERDDCEYLHMVGVGDKDKVLLLEDPAITERKLHGLAASQPISV
BLAST of Carg02337 vs. NCBI nr
Match: XP_022939464.1 (BAG family molecular chaperone regulator 2-like [Cucurbita moschata]) HSP 1 Score: 268.9 bits (686), Expect = 9.8e-69 Identity = 138/161 (85.71%), Postives = 138/161 (85.71%), Query Frame = 0
BLAST of Carg02337 vs. NCBI nr
Match: XP_023551354.1 (BAG family molecular chaperone regulator 4-like [Cucurbita pepo subsp. pepo]) HSP 1 Score: 254.6 bits (649), Expect = 1.9e-64 Identity = 131/161 (81.37%), Postives = 133/161 (82.61%), Query Frame = 0
BLAST of Carg02337 vs. NCBI nr
Match: XP_022992814.1 (BAG family molecular chaperone regulator 4-like [Cucurbita maxima]) HSP 1 Score: 243.4 bits (620), Expect = 4.4e-61 Identity = 127/162 (78.40%), Postives = 130/162 (80.25%), Query Frame = 0
BLAST of Carg02337 vs. NCBI nr
Match: XP_022991159.1 (BAG family molecular chaperone regulator 2-like [Cucurbita maxima]) HSP 1 Score: 199.5 bits (506), Expect = 7.3e-48 Identity = 105/161 (65.22%), Postives = 116/161 (72.05%), Query Frame = 0
BLAST of Carg02337 vs. NCBI nr
Match: XP_022955050.1 (BAG family molecular chaperone regulator 2-like [Cucurbita moschata] >XP_023518185.1 BAG family molecular chaperone regulator 2 [Cucurbita pepo subsp. pepo]) HSP 1 Score: 199.1 bits (505), Expect = 9.6e-48 Identity = 105/161 (65.22%), Postives = 116/161 (72.05%), Query Frame = 0
BLAST of Carg02337 vs. TAIR10
Match: AT5G14360.1 (Ubiquitin-like superfamily protein) HSP 1 Score: 96.7 bits (239), Expect = 1.2e-20 Identity = 54/108 (50.00%), Postives = 65/108 (60.19%), Query Frame = 0
BLAST of Carg02337 vs. TAIR10
Match: AT5G40630.1 (Ubiquitin-like superfamily protein) HSP 1 Score: 85.5 bits (210), Expect = 2.8e-17 Identity = 52/107 (48.60%), Postives = 63/107 (58.88%), Query Frame = 0
BLAST of Carg02337 vs. TAIR10
Match: AT5G62100.1 (BCL-2-associated athanogene 2) HSP 1 Score: 55.1 bits (131), Expect = 4.1e-08 Identity = 38/104 (36.54%), Postives = 52/104 (50.00%), Query Frame = 0
BLAST of Carg02337 vs. TAIR10
Match: AT5G52060.1 (BCL-2-associated athanogene 1) HSP 1 Score: 54.7 bits (130), Expect = 5.3e-08 Identity = 37/109 (33.94%), Postives = 52/109 (47.71%), Query Frame = 0
BLAST of Carg02337 vs. TAIR10
Match: AT3G51780.1 (BCL-2-associated athanogene 4) HSP 1 Score: 52.8 bits (125), Expect = 2.0e-07 Identity = 43/139 (30.94%), Postives = 58/139 (41.73%), Query Frame = 0
BLAST of Carg02337 vs. Swiss-Prot
Match: sp|Q0WPX7|BAG2_ARATH (BAG family molecular chaperone regulator 2 OS=Arabidopsis thaliana OX=3702 GN=BAG2 PE=1 SV=1) HSP 1 Score: 55.1 bits (131), Expect = 7.3e-07 Identity = 38/104 (36.54%), Postives = 52/104 (50.00%), Query Frame = 0
BLAST of Carg02337 vs. Swiss-Prot
Match: sp|Q0WUQ1|BAG1_ARATH (BAG family molecular chaperone regulator 1 OS=Arabidopsis thaliana OX=3702 GN=BAG1 PE=1 SV=1) HSP 1 Score: 54.7 bits (130), Expect = 9.5e-07 Identity = 37/109 (33.94%), Postives = 52/109 (47.71%), Query Frame = 0
BLAST of Carg02337 vs. Swiss-Prot
Match: sp|Q8RX71|BAG4_ARATH (BAG family molecular chaperone regulator 4 OS=Arabidopsis thaliana OX=3702 GN=BAG4 PE=1 SV=1) HSP 1 Score: 52.8 bits (125), Expect = 3.6e-06 Identity = 43/139 (30.94%), Postives = 58/139 (41.73%), Query Frame = 0
BLAST of Carg02337 vs. Swiss-Prot
Match: sp|Q9LYP4|BAG3_ARATH (BAG family molecular chaperone regulator 3 OS=Arabidopsis thaliana OX=3702 GN=BAG3 PE=1 SV=1) HSP 1 Score: 51.2 bits (121), Expect = 1.1e-05 Identity = 35/106 (33.02%), Postives = 49/106 (46.23%), Query Frame = 0
BLAST of Carg02337 vs. TrEMBL
Match: tr|A0A0A0KNY5|A0A0A0KNY5_CUCSA (Protein binding protein OS=Cucumis sativus OX=3659 GN=Csa_5G517800 PE=4 SV=1) HSP 1 Score: 193.7 bits (491), Expect = 2.7e-46 Identity = 107/166 (64.46%), Postives = 116/166 (69.88%), Query Frame = 0
BLAST of Carg02337 vs. TrEMBL
Match: tr|A0A1S3C9E0|A0A1S3C9E0_CUCME (BAG family molecular chaperone regulator 2-like OS=Cucumis melo OX=3656 GN=LOC103498131 PE=4 SV=1) HSP 1 Score: 191.0 bits (484), Expect = 1.7e-45 Identity = 105/166 (63.25%), Postives = 114/166 (68.67%), Query Frame = 0
BLAST of Carg02337 vs. TrEMBL
Match: tr|B9SLT0|B9SLT0_RICCO (Protein binding protein, putative OS=Ricinus communis OX=3988 GN=RCOM_0531000 PE=4 SV=1) HSP 1 Score: 134.0 bits (336), Expect = 2.5e-28 Identity = 80/159 (50.31%), Postives = 95/159 (59.75%), Query Frame = 0
BLAST of Carg02337 vs. TrEMBL
Match: tr|B9GIX8|B9GIX8_POPTR (Uncharacterized protein OS=Populus trichocarpa OX=3694 GN=POPTR_001G339100v3 PE=4 SV=1) HSP 1 Score: 129.4 bits (324), Expect = 6.2e-27 Identity = 82/159 (51.57%), Postives = 91/159 (57.23%), Query Frame = 0
BLAST of Carg02337 vs. TrEMBL
Match: tr|A0A061EDX8|A0A061EDX8_THECC (Binding protein, putative OS=Theobroma cacao OX=3641 GN=TCM_017044 PE=4 SV=1) HSP 1 Score: 129.0 bits (323), Expect = 8.1e-27 Identity = 84/159 (52.83%), Postives = 95/159 (59.75%), Query Frame = 0
The following BLAST results are available for this feature:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of silver-seed gourd
Date Performed: 2019-03-07
The following gene(s) are orthologous to this gene: The following gene(s) are paralogous to this gene:
The following block(s) are covering this gene:
|