Bhi06G001557 (gene) Wax gourd
The following sequences are available for this feature:
Legend: polypeptideexonCDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGATCCCTACCTTATTGACCGCAACTTCTGTATTTATTATTGCCTTCATTGCTGCTCCTCCAGTAGATATTGATGGTATTCGTGAACCTGTTTCTGGATCTCTACTTTACAGAAACAATATTATTTCTGGTGCTATTATCCCTGCTTCTGCAGCTATTGGTTTGCACTTTTACCCAATTTGGGAAGTTGCTTCCGTTGATGAATGGTTATACAATGGTGGTCCTTATGAGCTAATGGTTCTACACTTCTTACTTGATGTAGCATGTTAA ATGATCCCTACCTTATTGACCGCAACTTCTGTATTTATTATTGCCTTCATTGCTGCTCCTCCAGTAGATATTGATGGTATTCGTGAACCTGTTTCTGGATCTCTACTTTACAGAAACAATATTATTTCTGGTGCTATTATCCCTGCTTCTGCAGCTATTGGTTTGCACTTTTACCCAATTTGGGAAGTTGCTTCCGTTGATGAATGGTTATACAATGGTGGTCCTTATGAGCTAATGGTTCTACACTTCTTACTTGATGTAGCATGTTAA ATGATCCCTACCTTATTGACCGCAACTTCTGTATTTATTATTGCCTTCATTGCTGCTCCTCCAGTAGATATTGATGGTATTCGTGAACCTGTTTCTGGATCTCTACTTTACAGAAACAATATTATTTCTGGTGCTATTATCCCTGCTTCTGCAGCTATTGGTTTGCACTTTTACCCAATTTGGGAAGTTGCTTCCGTTGATGAATGGTTATACAATGGTGGTCCTTATGAGCTAATGGTTCTACACTTCTTACTTGATGTAGCATGTTAA MIPTLLTATSVFIIAFIAAPPVDIDGIREPVSGSLLYRNNIISGAIIPASAAIGLHFYPIWEVASVDEWLYNGGPYELMVLHFLLDVAC
BLAST of Bhi06G001557 vs. Swiss-Prot
Match: sp|Q3V554|PSBA_ACOCL (Photosystem II protein D1 OS=Acorus calamus OX=4465 GN=psbA PE=3 SV=1) HSP 1 Score: 170.6 bits (431), Expect = 7.7e-42 Identity = 84/89 (94.38%), Postives = 85/89 (95.51%), Query Frame = 0
BLAST of Bhi06G001557 vs. Swiss-Prot
Match: sp|A4QJ96|PSBA_AETCO (Photosystem II protein D1 OS=Aethionema cordifolium OX=434059 GN=psbA PE=3 SV=1) HSP 1 Score: 170.6 bits (431), Expect = 7.7e-42 Identity = 84/89 (94.38%), Postives = 85/89 (95.51%), Query Frame = 0
BLAST of Bhi06G001557 vs. Swiss-Prot
Match: sp|A4QJI0|PSBA_AETGR (Photosystem II protein D1 OS=Aethionema grandiflorum OX=72657 GN=psbA PE=3 SV=1) HSP 1 Score: 170.6 bits (431), Expect = 7.7e-42 Identity = 84/89 (94.38%), Postives = 85/89 (95.51%), Query Frame = 0
BLAST of Bhi06G001557 vs. Swiss-Prot
Match: sp|A1E9Y8|PSBA_AGRST (Photosystem II protein D1 OS=Agrostis stolonifera OX=63632 GN=psbA PE=3 SV=1) HSP 1 Score: 170.6 bits (431), Expect = 7.7e-42 Identity = 84/89 (94.38%), Postives = 85/89 (95.51%), Query Frame = 0
BLAST of Bhi06G001557 vs. Swiss-Prot
Match: sp|P02956|PSBA_AMAHY (Photosystem II protein D1 OS=Amaranthus hybridus OX=3565 GN=psbA PE=3 SV=1) HSP 1 Score: 170.6 bits (431), Expect = 7.7e-42 Identity = 84/89 (94.38%), Postives = 85/89 (95.51%), Query Frame = 0
BLAST of Bhi06G001557 vs. TAIR10
Match: ATCG00020.1 (photosystem II reaction center protein A) HSP 1 Score: 170.6 bits (431), Expect = 4.3e-43 Identity = 84/89 (94.38%), Postives = 85/89 (95.51%), Query Frame = 0
BLAST of Bhi06G001557 vs. TrEMBL
Match: tr|A0A0A0UU45|A0A0A0UU45_9ASPA (Photosystem II protein D1 OS=Corallorhiza maculata var. mexicana OX=512271 GN=psbA PE=3 SV=1) HSP 1 Score: 171.8 bits (434), Expect = 7.0e-40 Identity = 84/89 (94.38%), Postives = 86/89 (96.63%), Query Frame = 0
BLAST of Bhi06G001557 vs. TrEMBL
Match: tr|A0A221HMF3|A0A221HMF3_9ERIC (Photosystem II protein D1 OS=Pyrenaria spectabilis var. greeniae OX=197092 GN=psbA PE=3 SV=1) HSP 1 Score: 170.6 bits (431), Expect = 1.6e-39 Identity = 84/89 (94.38%), Postives = 85/89 (95.51%), Query Frame = 0
BLAST of Bhi06G001557 vs. TrEMBL
Match: tr|A0A2P1AEC5|A0A2P1AEC5_9MAGN (Photosystem II protein D1 OS=Parrotia subaequalis OX=64134 GN=psbA PE=3 SV=1) HSP 1 Score: 170.6 bits (431), Expect = 1.6e-39 Identity = 84/89 (94.38%), Postives = 85/89 (95.51%), Query Frame = 0
BLAST of Bhi06G001557 vs. TrEMBL
Match: tr|A0A140G1P2|A0A140G1P2_TOBAC (Photosystem II protein D1 OS=Nicotiana tabacum OX=4097 GN=psbA PE=3 SV=1) HSP 1 Score: 170.6 bits (431), Expect = 1.6e-39 Identity = 84/89 (94.38%), Postives = 85/89 (95.51%), Query Frame = 0
BLAST of Bhi06G001557 vs. TrEMBL
Match: tr|A0A059P2J4|A0A059P2J4_9GENT (Photosystem II protein D1 OS=Asclepias coulteri OX=659948 GN=psbA PE=3 SV=1) HSP 1 Score: 170.6 bits (431), Expect = 1.6e-39 Identity = 84/89 (94.38%), Postives = 85/89 (95.51%), Query Frame = 0
BLAST of Bhi06G001557 vs. NCBI nr
Match: AIW51318.1 (photosystem II protein D1 (plastid) [Corallorhiza maculata var. mexicana]) HSP 1 Score: 171.8 bits (434), Expect = 1.1e-39 Identity = 84/89 (94.38%), Postives = 86/89 (96.63%), Query Frame = 0
BLAST of Bhi06G001557 vs. NCBI nr
Match: AAK50366.1 (Q(B) polypeptide, partial (chloroplast) [Medicago sativa]) HSP 1 Score: 170.6 bits (431), Expect = 2.4e-39 Identity = 84/89 (94.38%), Postives = 85/89 (95.51%), Query Frame = 0
BLAST of Bhi06G001557 vs. NCBI nr
Match: BAA82767.1 (psbA [Conocephalum conicum]) HSP 1 Score: 170.6 bits (431), Expect = 2.4e-39 Identity = 84/89 (94.38%), Postives = 85/89 (95.51%), Query Frame = 0
BLAST of Bhi06G001557 vs. NCBI nr
Match: AAM34438.1 (photosystem II protein D1, partial (chloroplast) [Olea europaea]) HSP 1 Score: 170.6 bits (431), Expect = 2.4e-39 Identity = 84/89 (94.38%), Postives = 85/89 (95.51%), Query Frame = 0
BLAST of Bhi06G001557 vs. NCBI nr
Match: AAM34437.1 (photosystem II protein D1, partial (chloroplast) [Citrus reticulata]) HSP 1 Score: 170.6 bits (431), Expect = 2.4e-39 Identity = 84/89 (94.38%), Postives = 85/89 (95.51%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of wax gourd
Date Performed: 2019-11-17
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene: |