Bhi06G000869 (gene) Wax gourd
The following sequences are available for this feature:
Legend: polypeptideexonCDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGCAGAAACACATCAAGCATGGAGACAAATCCTGAAAACGACGCCGTGTTGGGATCAAGAGAAGGCGTTTGCCGACGACGTCGCCGCCGTGTGGCCACCGAGATCTTACTCCTGCAACTTCTGTATGAGACAATTTCGGTCAGCTCAAGCTTTGGGTGGCCACATGAACGTCCATCGAAGAGACCGTGCTAAGCTTCAAAACCATCCCAACCGTCCATTCTTCATCAAACCATCTCCCACCTTTGATCTTCTTACTCACCATTTTTTTCCCAAAAACAACTCTTCTTCTCCCCTTTCTTCTCCATTCTCTCTCAAAAGACCTAAACTTTCTTCTTCTTCTTCTTCTTCTAATTCTGAGCTCCTCAACCTTGACCTTGACCTCAAGCTATAA ATGGCAGAAACACATCAAGCATGGAGACAAATCCTGAAAACGACGCCGTGTTGGGATCAAGAGAAGGCGTTTGCCGACGACGTCGCCGCCGTGTGGCCACCGAGATCTTACTCCTGCAACTTCTGTATGAGACAATTTCGGTCAGCTCAAGCTTTGGGTGGCCACATGAACGTCCATCGAAGAGACCGTGCTAAGCTTCAAAACCATCCCAACCGTCCATTCTTCATCAAACCATCTCCCACCTTTGATCTTCTTACTCACCATTTTTTTCCCAAAAACAACTCTTCTTCTCCCCTTTCTTCTCCATTCTCTCTCAAAAGACCTAAACTTTCTTCTTCTTCTTCTTCTTCTAATTCTGAGCTCCTCAACCTTGACCTTGACCTCAAGCTATAA ATGGCAGAAACACATCAAGCATGGAGACAAATCCTGAAAACGACGCCGTGTTGGGATCAAGAGAAGGCGTTTGCCGACGACGTCGCCGCCGTGTGGCCACCGAGATCTTACTCCTGCAACTTCTGTATGAGACAATTTCGGTCAGCTCAAGCTTTGGGTGGCCACATGAACGTCCATCGAAGAGACCGTGCTAAGCTTCAAAACCATCCCAACCGTCCATTCTTCATCAAACCATCTCCCACCTTTGATCTTCTTACTCACCATTTTTTTCCCAAAAACAACTCTTCTTCTCCCCTTTCTTCTCCATTCTCTCTCAAAAGACCTAAACTTTCTTCTTCTTCTTCTTCTTCTAATTCTGAGCTCCTCAACCTTGACCTTGACCTCAAGCTATAA MAETHQAWRQILKTTPCWDQEKAFADDVAAVWPPRSYSCNFCMRQFRSAQALGGHMNVHRRDRAKLQNHPNRPFFIKPSPTFDLLTHHFFPKNNSSSPLSSPFSLKRPKLSSSSSSSNSELLNLDLDLKL
BLAST of Bhi06G000869 vs. Swiss-Prot
Match: sp|O80942|ZFP10_ARATH (Zinc finger protein 10 OS=Arabidopsis thaliana OX=3702 GN=ZFP10 PE=2 SV=1) HSP 1 Score: 84.3 bits (207), Expect = 1.1e-15 Identity = 40/70 (57.14%), Postives = 54/70 (77.14%), Query Frame = 0
BLAST of Bhi06G000869 vs. Swiss-Prot
Match: sp|Q9LHS9|RBE_ARATH (Probable transcriptional regulator RABBIT EARS OS=Arabidopsis thaliana OX=3702 GN=RBE PE=2 SV=2) HSP 1 Score: 75.1 bits (183), Expect = 6.4e-13 Identity = 35/60 (58.33%), Postives = 43/60 (71.67%), Query Frame = 0
BLAST of Bhi06G000869 vs. Swiss-Prot
Match: sp|Q9SLB8|ZFP11_ARATH (Zinc finger protein 11 OS=Arabidopsis thaliana OX=3702 GN=ZFP11 PE=2 SV=1) HSP 1 Score: 74.3 bits (181), Expect = 1.1e-12 Identity = 30/40 (75.00%), Postives = 37/40 (92.50%), Query Frame = 0
BLAST of Bhi06G000869 vs. Swiss-Prot
Match: sp|Q38895|SUP_ARATH (Transcriptional regulator SUPERMAN OS=Arabidopsis thaliana OX=3702 GN=SUP PE=1 SV=1) HSP 1 Score: 65.5 bits (158), Expect = 5.1e-10 Identity = 26/30 (86.67%), Postives = 29/30 (96.67%), Query Frame = 0
BLAST of Bhi06G000869 vs. Swiss-Prot
Match: sp|Q9SR34|TAC1_ARATH (Transcriptional regulator TAC1 OS=Arabidopsis thaliana OX=3702 GN=TAC1 PE=2 SV=1) HSP 1 Score: 59.7 bits (143), Expect = 2.8e-08 Identity = 25/33 (75.76%), Postives = 30/33 (90.91%), Query Frame = 0
BLAST of Bhi06G000869 vs. TAIR10
Match: AT2G37740.1 (zinc-finger protein 10) HSP 1 Score: 84.3 bits (207), Expect = 5.9e-17 Identity = 40/70 (57.14%), Postives = 54/70 (77.14%), Query Frame = 0
BLAST of Bhi06G000869 vs. TAIR10
Match: AT4G17810.1 (C2H2 and C2HC zinc fingers superfamily protein) HSP 1 Score: 77.0 bits (188), Expect = 9.4e-15 Identity = 35/53 (66.04%), Postives = 38/53 (71.70%), Query Frame = 0
BLAST of Bhi06G000869 vs. TAIR10
Match: AT5G06070.1 (C2H2 and C2HC zinc fingers superfamily protein) HSP 1 Score: 75.1 bits (183), Expect = 3.6e-14 Identity = 35/60 (58.33%), Postives = 43/60 (71.67%), Query Frame = 0
BLAST of Bhi06G000869 vs. TAIR10
Match: AT2G42410.1 (zinc finger protein 11) HSP 1 Score: 74.3 bits (181), Expect = 6.1e-14 Identity = 30/40 (75.00%), Postives = 37/40 (92.50%), Query Frame = 0
BLAST of Bhi06G000869 vs. TAIR10
Match: AT3G23130.1 (C2H2 and C2HC zinc fingers superfamily protein) HSP 1 Score: 65.5 bits (158), Expect = 2.8e-11 Identity = 26/30 (86.67%), Postives = 29/30 (96.67%), Query Frame = 0
BLAST of Bhi06G000869 vs. TrEMBL
Match: tr|A0A0A0KLQ3|A0A0A0KLQ3_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_5G183770 PE=4 SV=1) HSP 1 Score: 199.1 bits (505), Expect = 6.0e-48 Identity = 95/110 (86.36%), Postives = 98/110 (89.09%), Query Frame = 0
BLAST of Bhi06G000869 vs. TrEMBL
Match: tr|A0A1S3CGM6|A0A1S3CGM6_CUCME (transcriptional regulator SUPERMAN-like OS=Cucumis melo OX=3656 GN=LOC103500239 PE=4 SV=1) HSP 1 Score: 195.7 bits (496), Expect = 6.6e-47 Identity = 91/101 (90.10%), Postives = 93/101 (92.08%), Query Frame = 0
BLAST of Bhi06G000869 vs. TrEMBL
Match: tr|A0A1R3I247|A0A1R3I247_9ROSI (Zinc finger, C2H2-like protein OS=Corchorus olitorius OX=93759 GN=COLO4_25487 PE=4 SV=1) HSP 1 Score: 94.4 bits (233), Expect = 2.1e-16 Identity = 49/88 (55.68%), Postives = 62/88 (70.45%), Query Frame = 0
BLAST of Bhi06G000869 vs. TrEMBL
Match: tr|A0A1R3GLU0|A0A1R3GLU0_COCAP (Zinc finger, C2H2-like protein OS=Corchorus capsularis OX=210143 GN=CCACVL1_25101 PE=4 SV=1) HSP 1 Score: 92.4 bits (228), Expect = 7.9e-16 Identity = 49/106 (46.23%), Postives = 65/106 (61.32%), Query Frame = 0
BLAST of Bhi06G000869 vs. TrEMBL
Match: tr|V7AKE9|V7AKE9_PHAVU (Uncharacterized protein OS=Phaseolus vulgaris OX=3885 GN=PHAVU_010G016300g PE=4 SV=1) HSP 1 Score: 92.4 bits (228), Expect = 7.9e-16 Identity = 48/90 (53.33%), Postives = 60/90 (66.67%), Query Frame = 0
BLAST of Bhi06G000869 vs. NCBI nr
Match: XP_004151402.2 (PREDICTED: transcriptional regulator SUPERMAN-like [Cucumis sativus] >KGN50575.1 hypothetical protein Csa_5G183770 [Cucumis sativus]) HSP 1 Score: 199.1 bits (505), Expect = 9.0e-48 Identity = 95/110 (86.36%), Postives = 98/110 (89.09%), Query Frame = 0
BLAST of Bhi06G000869 vs. NCBI nr
Match: XP_008461701.1 (PREDICTED: transcriptional regulator SUPERMAN-like [Cucumis melo]) HSP 1 Score: 195.7 bits (496), Expect = 1.0e-46 Identity = 91/101 (90.10%), Postives = 93/101 (92.08%), Query Frame = 0
BLAST of Bhi06G000869 vs. NCBI nr
Match: XP_023542190.1 (zinc finger protein 10-like [Cucurbita pepo subsp. pepo]) HSP 1 Score: 156.4 bits (394), Expect = 6.7e-35 Identity = 82/117 (70.09%), Postives = 89/117 (76.07%), Query Frame = 0
BLAST of Bhi06G000869 vs. NCBI nr
Match: XP_022988302.1 (zinc finger protein 10-like [Cucurbita maxima]) HSP 1 Score: 154.5 bits (389), Expect = 2.6e-34 Identity = 81/117 (69.23%), Postives = 89/117 (76.07%), Query Frame = 0
BLAST of Bhi06G000869 vs. NCBI nr
Match: OMO76665.1 (Zinc finger, C2H2-like protein [Corchorus olitorius]) HSP 1 Score: 94.4 bits (233), Expect = 3.1e-16 Identity = 49/88 (55.68%), Postives = 62/88 (70.45%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of wax gourd
Date Performed: 2019-11-17
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene:
The following block(s) are covering this gene:
|