Bhi05G000938 (gene) Wax gourd
The following sequences are available for this feature:
Legend: polypeptideexonCDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGGTATCTTCAAACCAAAGGCTTGGTTATCTGTTGCCACTGATCTAGACACGGCTAAACCTCGTTCTTATAAGGAAACTTTGTTGCATACTAAATGGCATCGTGTAATGCTTTATGAGTATGAGGCTTTTATTCGAAATCAAACATGGTCTTTAGTGCCCTTACCCTCCGATCGGAAAATCATTGGAAGCAAATGGGTCTTTCGACTTAAACACAAACAATCTAGTGAAGTTGATCAGTTTAAGGCCCGACTAGTTGCCCAAGGATTCAGCCAAGACTATGGTATTGATTATTTTGGCACCTTTAGTCCAGTTGTTAAACCTACTACAATCTGCATT ATGGGTATCTTCAAACCAAAGGCTTGGTTATCTGTTGCCACTGATCTAGACACGGCTAAACCTCGTTCTTATAAGGAAACTTTGTTGCATACTAAATGGCATCGTGTAATGCTTTATGAGTATGAGGCTTTTATTCGAAATCAAACATGGTCTTTAGTGCCCTTACCCTCCGATCGGAAAATCATTGGAAGCAAATGGGTCTTTCGACTTAAACACAAACAATCTAGTGAAGTTGATCAGTTTAAGGCCCGACTAGTTGCCCAAGGATTCAGCCAAGACTATGGTATTGATTATTTTGGCACCTTTAGTCCAGTTGTTAAACCTACTACAATCTGCATT ATGGGTATCTTCAAACCAAAGGCTTGGTTATCTGTTGCCACTGATCTAGACACGGCTAAACCTCGTTCTTATAAGGAAACTTTGTTGCATACTAAATGGCATCGTGTAATGCTTTATGAGTATGAGGCTTTTATTCGAAATCAAACATGGTCTTTAGTGCCCTTACCCTCCGATCGGAAAATCATTGGAAGCAAATGGGTCTTTCGACTTAAACACAAACAATCTAGTGAAGTTGATCAGTTTAAGGCCCGACTAGTTGCCCAAGGATTCAGCCAAGACTATGGTATTGATTATTTTGGCACCTTTAGTCCAGTTGTTAAACCTACTACAATCTGCATT MGIFKPKAWLSVATDLDTAKPRSYKETLLHTKWHRVMLYEYEAFIRNQTWSLVPLPSDRKIIGSKWVFRLKHKQSSEVDQFKARLVAQGFSQDYGIDYFGTFSPVVKPTTICI
BLAST of Bhi05G000938 vs. Swiss-Prot
Match: sp|Q94HW2|POLR1_ARATH (Retrovirus-related Pol polyprotein from transposon RE1 OS=Arabidopsis thaliana OX=3702 GN=RE1 PE=2 SV=1) HSP 1 Score: 90.5 bits (223), Expect = 1.3e-17 Identity = 48/114 (42.11%), Postives = 68/114 (59.65%), Query Frame = 0
BLAST of Bhi05G000938 vs. Swiss-Prot
Match: sp|Q9ZT94|POLR2_ARATH (Retrovirus-related Pol polyprotein from transposon RE2 OS=Arabidopsis thaliana OX=3702 GN=RE2 PE=4 SV=1) HSP 1 Score: 87.8 bits (216), Expect = 8.3e-17 Identity = 47/114 (41.23%), Postives = 67/114 (58.77%), Query Frame = 0
BLAST of Bhi05G000938 vs. Swiss-Prot
Match: sp|P92520|M820_ARATH (Uncharacterized mitochondrial protein AtMg00820 OS=Arabidopsis thaliana OX=3702 GN=AtMg00820 PE=4 SV=1) HSP 1 Score: 86.3 bits (212), Expect = 2.4e-16 Identity = 45/106 (42.45%), Postives = 64/106 (60.38%), Query Frame = 0
BLAST of Bhi05G000938 vs. Swiss-Prot
Match: sp|P10978|POLX_TOBAC (Retrovirus-related Pol polyprotein from transposon TNT 1-94 OS=Nicotiana tabacum OX=4097 PE=2 SV=1) HSP 1 Score: 76.3 bits (186), Expect = 2.5e-13 Identity = 41/98 (41.84%), Postives = 59/98 (60.20%), Query Frame = 0
BLAST of Bhi05G000938 vs. Swiss-Prot
Match: sp|P04146|COPIA_DROME (Copia protein OS=Drosophila melanogaster OX=7227 GN=GIP PE=1 SV=3) HSP 1 Score: 69.7 bits (169), Expect = 2.3e-11 Identity = 30/77 (38.96%), Postives = 47/77 (61.04%), Query Frame = 0
BLAST of Bhi05G000938 vs. TAIR10
Match: ATMG00820.1 (Reverse transcriptase (RNA-dependent DNA polymerase)) HSP 1 Score: 86.3 bits (212), Expect = 1.3e-17 Identity = 45/106 (42.45%), Postives = 64/106 (60.38%), Query Frame = 0
BLAST of Bhi05G000938 vs. TAIR10
Match: AT4G23160.1 (cysteine-rich RLK (RECEPTOR-like protein kinase) 8) HSP 1 Score: 79.7 bits (195), Expect = 1.3e-15 Identity = 36/92 (39.13%), Postives = 55/92 (59.78%), Query Frame = 0
BLAST of Bhi05G000938 vs. TrEMBL
Match: tr|A5AXM3|A5AXM3_VITVI (Uncharacterized protein OS=Vitis vinifera OX=29760 GN=VITISV_012673 PE=4 SV=1) HSP 1 Score: 130.6 bits (327), Expect = 2.3e-27 Identity = 61/112 (54.46%), Postives = 75/112 (66.96%), Query Frame = 0
BLAST of Bhi05G000938 vs. TrEMBL
Match: tr|A5AQ04|A5AQ04_VITVI (Uncharacterized protein OS=Vitis vinifera OX=29760 GN=VITISV_034738 PE=4 SV=1) HSP 1 Score: 130.2 bits (326), Expect = 3.0e-27 Identity = 65/110 (59.09%), Postives = 79/110 (71.82%), Query Frame = 0
BLAST of Bhi05G000938 vs. TrEMBL
Match: tr|A5CAE5|A5CAE5_VITVI (Uncharacterized protein OS=Vitis vinifera OX=29760 GN=VITISV_020209 PE=4 SV=1) HSP 1 Score: 129.4 bits (324), Expect = 5.1e-27 Identity = 65/110 (59.09%), Postives = 79/110 (71.82%), Query Frame = 0
BLAST of Bhi05G000938 vs. TrEMBL
Match: tr|A5ATX2|A5ATX2_VITVI (Uncharacterized protein OS=Vitis vinifera OX=29760 GN=VITISV_036649 PE=4 SV=1) HSP 1 Score: 124.0 bits (310), Expect = 2.1e-25 Identity = 63/110 (57.27%), Postives = 76/110 (69.09%), Query Frame = 0
BLAST of Bhi05G000938 vs. TrEMBL
Match: tr|A0A2N9GHZ2|A0A2N9GHZ2_FAGSY (Uncharacterized protein OS=Fagus sylvatica OX=28930 GN=FSB_LOCUS29989 PE=4 SV=1) HSP 1 Score: 121.7 bits (304), Expect = 1.1e-24 Identity = 52/110 (47.27%), Postives = 72/110 (65.45%), Query Frame = 0
BLAST of Bhi05G000938 vs. NCBI nr
Match: CAN76151.1 (hypothetical protein VITISV_012673 [Vitis vinifera]) HSP 1 Score: 130.6 bits (327), Expect = 3.4e-27 Identity = 61/112 (54.46%), Postives = 75/112 (66.96%), Query Frame = 0
BLAST of Bhi05G000938 vs. NCBI nr
Match: CAN71553.1 (hypothetical protein VITISV_034738 [Vitis vinifera]) HSP 1 Score: 130.2 bits (326), Expect = 4.5e-27 Identity = 65/110 (59.09%), Postives = 79/110 (71.82%), Query Frame = 0
BLAST of Bhi05G000938 vs. NCBI nr
Match: CAN75478.1 (hypothetical protein VITISV_020209 [Vitis vinifera]) HSP 1 Score: 129.4 bits (324), Expect = 7.6e-27 Identity = 65/110 (59.09%), Postives = 79/110 (71.82%), Query Frame = 0
BLAST of Bhi05G000938 vs. NCBI nr
Match: CAN73795.1 (hypothetical protein VITISV_036649 [Vitis vinifera]) HSP 1 Score: 124.0 bits (310), Expect = 3.2e-25 Identity = 63/110 (57.27%), Postives = 76/110 (69.09%), Query Frame = 0
BLAST of Bhi05G000938 vs. NCBI nr
Match: XP_020978287.1 (uncharacterized protein LOC110271621 [Arachis ipaensis]) HSP 1 Score: 120.9 bits (302), Expect = 2.7e-24 Identity = 60/110 (54.55%), Postives = 72/110 (65.45%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of wax gourd
Date Performed: 2019-11-17
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene: |