Bhi05G000084 (gene) Wax gourd
The following sequences are available for this feature:
Legend: polypeptideexonCDS Hold the cursor over a type above to highlight its positions in the sequence below.GGTGAACCATGCTTTGCATACCGCTTTAGTCGTTGGAGGGTTCGAGTATTTAACAACATGAAAAATGGAGAAACATTGTTCATTCATTGCAAATCAAGAGACGACGATTTGGGACTGCATTACCTCGATGTCGGAAAGCAACTTACATGGAGCTTTAGAGAGAATCTATGGTCCTCGACACTCTTTTGGTGCTACATTCACAATAAAGATGGTCATGTCTCTTTAGAAGTGTTTAATGCTTATGATCCTAACTTATACTATAGATGTCAGGGGTTAGAGTGCATTTGGTCAATAAGGGAGGATGGAGTCTATGTGAGAAATAGAGCTTTTTACAATCGATTTGAATTGATAGGTAAGTGGGAGCCTGGTTGGTAG GGTGAACCATGCTTTGCATACCGCTTTAGTCGTTGGAGGGTTCGAGTATTTAACAACATGAAAAATGGAGAAACATTGTTCATTCATTGCAAATCAAGAGACGACGATTTGGGACTGCATTACCTCGATGTCGGAAAGCAACTTACATGGAGCTTTAGAGAGAATCTATGGTCCTCGACACTCTTTTGGTGCTACATTCACAATAAAGATGGTCATGTCTCTTTAGAAGTGTTTAATGCTTATGATCCTAACTTATACTATAGATGTCAGGGGTTAGAGTGCATTTGGTCAATAAGGGAGGATGGAGTCTATGTGAGAAATAGAGCTTTTTACAATCGATTTGAATTGATAGGTAAGTGGGAGCCTGGTTGGTAG GGTGAACCATGCTTTGCATACCGCTTTAGTCGTTGGAGGGTTCGAGTATTTAACAACATGAAAAATGGAGAAACATTGTTCATTCATTGCAAATCAAGAGACGACGATTTGGGACTGCATTACCTCGATGTCGGAAAGCAACTTACATGGAGCTTTAGAGAGAATCTATGGTCCTCGACACTCTTTTGGTGCTACATTCACAATAAAGATGGTCATGTCTCTTTAGAAGTGTTTAATGCTTATGATCCTAACTTATACTATAGATGTCAGGGGTTAGAGTGCATTTGGTCAATAAGGGAGGATGGAGTCTATGTGAGAAATAGAGCTTTTTACAATCGATTTGAATTGATAGGTAAGTGGGAGCCTGGTTGGTAG GEPCFAYRFSRWRVRVFNNMKNGETLFIHCKSRDDDLGLHYLDVGKQLTWSFRENLWSSTLFWCYIHNKDGHVSLEVFNAYDPNLYYRCQGLECIWSIREDGVYVRNRAFYNRFELIGKWEPGW
BLAST of Bhi05G000084 vs. Swiss-Prot
Match: sp|F4JLS0|SPH1_ARATH (S-protein homolog 1 OS=Arabidopsis thaliana OX=3702 GN=SPH1 PE=2 SV=1) HSP 1 Score: 115.5 bits (288), Expect = 4.1e-25 Identity = 52/117 (44.44%), Postives = 73/117 (62.39%), Query Frame = 0
BLAST of Bhi05G000084 vs. Swiss-Prot
Match: sp|Q2HQ46|SPH74_ARATH (S-protein homolog 74 OS=Arabidopsis thaliana OX=3702 GN=SPH74 PE=2 SV=1) HSP 1 Score: 115.5 bits (288), Expect = 4.1e-25 Identity = 51/117 (43.59%), Postives = 74/117 (63.25%), Query Frame = 0
BLAST of Bhi05G000084 vs. Swiss-Prot
Match: sp|P0DN92|SPH24_ARATH (S-protein homolog 24 OS=Arabidopsis thaliana OX=3702 GN=SPH24 PE=3 SV=1) HSP 1 Score: 74.7 bits (182), Expect = 8.0e-13 Identity = 43/107 (40.19%), Postives = 53/107 (49.53%), Query Frame = 0
BLAST of Bhi05G000084 vs. Swiss-Prot
Match: sp|Q9LW22|SPH21_ARATH (S-protein homolog 21 OS=Arabidopsis thaliana OX=3702 GN=SPH21 PE=3 SV=1) HSP 1 Score: 74.3 bits (181), Expect = 1.0e-12 Identity = 29/86 (33.72%), Postives = 48/86 (55.81%), Query Frame = 0
BLAST of Bhi05G000084 vs. Swiss-Prot
Match: sp|O23020|SPH5_ARATH (S-protein homolog 5 OS=Arabidopsis thaliana OX=3702 GN=SPH5 PE=2 SV=1) HSP 1 Score: 70.5 bits (171), Expect = 1.5e-11 Identity = 35/95 (36.84%), Postives = 51/95 (53.68%), Query Frame = 0
BLAST of Bhi05G000084 vs. TAIR10
Match: AT4G16295.1 (S-protein homologue 1) HSP 1 Score: 115.5 bits (288), Expect = 2.3e-26 Identity = 52/117 (44.44%), Postives = 73/117 (62.39%), Query Frame = 0
BLAST of Bhi05G000084 vs. TAIR10
Match: AT4G29035.1 (Plant self-incompatibility protein S1 family) HSP 1 Score: 115.5 bits (288), Expect = 2.3e-26 Identity = 51/117 (43.59%), Postives = 74/117 (63.25%), Query Frame = 0
BLAST of Bhi05G000084 vs. TAIR10
Match: AT3G26880.1 (Plant self-incompatibility protein S1 family) HSP 1 Score: 74.3 bits (181), Expect = 5.8e-14 Identity = 29/86 (33.72%), Postives = 48/86 (55.81%), Query Frame = 0
BLAST of Bhi05G000084 vs. TAIR10
Match: AT1G28305.1 (Plant self-incompatibility protein S1 family) HSP 1 Score: 71.2 bits (173), Expect = 4.9e-13 Identity = 36/107 (33.64%), Postives = 58/107 (54.21%), Query Frame = 0
BLAST of Bhi05G000084 vs. TAIR10
Match: AT1G04645.1 (Plant self-incompatibility protein S1 family) HSP 1 Score: 70.5 bits (171), Expect = 8.4e-13 Identity = 35/95 (36.84%), Postives = 51/95 (53.68%), Query Frame = 0
BLAST of Bhi05G000084 vs. TrEMBL
Match: tr|A0A1S4DWP0|A0A1S4DWP0_CUCME (pumilio homolog 15-like OS=Cucumis melo OX=3656 GN=LOC103490053 PE=4 SV=1) HSP 1 Score: 205.3 bits (521), Expect = 7.9e-50 Identity = 86/106 (81.13%), Postives = 95/106 (89.62%), Query Frame = 0
BLAST of Bhi05G000084 vs. TrEMBL
Match: tr|A0A2K2BPC1|A0A2K2BPC1_POPTR (Uncharacterized protein OS=Populus trichocarpa OX=3694 GN=POPTR_002G252500v3 PE=4 SV=1) HSP 1 Score: 129.8 bits (325), Expect = 4.2e-27 Identity = 51/116 (43.97%), Postives = 71/116 (61.21%), Query Frame = 0
BLAST of Bhi05G000084 vs. TrEMBL
Match: tr|A0A0D3DGQ0|A0A0D3DGQ0_BRAOL (Uncharacterized protein OS=Brassica oleracea var. oleracea OX=109376 GN=106305657 PE=4 SV=1) HSP 1 Score: 126.7 bits (317), Expect = 3.6e-26 Identity = 56/118 (47.46%), Postives = 80/118 (67.80%), Query Frame = 0
BLAST of Bhi05G000084 vs. TrEMBL
Match: tr|Q9FT11|Q9FT11_BRANA (Uncharacterized protein homologue of SPH OS=Brassica napus OX=3708 GN=homologue of SPH PE=4 SV=1) HSP 1 Score: 126.7 bits (317), Expect = 3.6e-26 Identity = 56/118 (47.46%), Postives = 80/118 (67.80%), Query Frame = 0
BLAST of Bhi05G000084 vs. TrEMBL
Match: tr|Q9LEP6|Q9LEP6_BRANA (BnaA03g58840D protein OS=Brassica napus OX=3708 GN=BnaA03g58840D PE=4 SV=1) HSP 1 Score: 125.6 bits (314), Expect = 8.0e-26 Identity = 54/117 (46.15%), Postives = 79/117 (67.52%), Query Frame = 0
BLAST of Bhi05G000084 vs. NCBI nr
Match: XP_016900393.1 (PREDICTED: pumilio homolog 15-like, partial [Cucumis melo]) HSP 1 Score: 205.3 bits (521), Expect = 1.2e-49 Identity = 86/106 (81.13%), Postives = 95/106 (89.62%), Query Frame = 0
BLAST of Bhi05G000084 vs. NCBI nr
Match: XP_023532937.1 (S-protein homolog 1-like [Cucurbita pepo subsp. pepo]) HSP 1 Score: 190.3 bits (482), Expect = 4.0e-45 Identity = 79/122 (64.75%), Postives = 94/122 (77.05%), Query Frame = 0
BLAST of Bhi05G000084 vs. NCBI nr
Match: XP_022931006.1 (S-protein homolog 1-like [Cucurbita moschata]) HSP 1 Score: 187.2 bits (474), Expect = 3.4e-44 Identity = 77/122 (63.11%), Postives = 93/122 (76.23%), Query Frame = 0
BLAST of Bhi05G000084 vs. NCBI nr
Match: XP_004136435.1 (PREDICTED: uncharacterized protein LOC101208617 [Cucumis sativus]) HSP 1 Score: 135.6 bits (340), Expect = 1.2e-28 Identity = 61/127 (48.03%), Postives = 80/127 (62.99%), Query Frame = 0
BLAST of Bhi05G000084 vs. NCBI nr
Match: XP_004136434.2 (PREDICTED: uncharacterized protein LOC101208376 [Cucumis sativus]) HSP 1 Score: 134.4 bits (337), Expect = 2.6e-28 Identity = 58/123 (47.15%), Postives = 78/123 (63.41%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of wax gourd
Date Performed: 2019-11-17
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene: |