Bhi04G001664 (gene) Wax gourd
The following sequences are available for this feature:
Legend: polypeptideCDSexon Hold the cursor over a type above to highlight its positions in the sequence below.ATGGCAGATTCAGAAGGGACCAGAGGGGAATGCGAACGAATCTTCAAACGGTTCGACAGCGACGGCGACGGGAAGATCTCGCTGTCGGAGCTGGAGAGTGCTCTTCGTGCCCTTGGCTCCTCCTCGCCGGAAGAGGTCCGACGACGGATGTCGGAAATCGATAAGGATGGCAATGGCTTCATTTCACTTGATGAACTCTGTGACTTTCAAAGGGCCAATCCTGATTTGATGAAGGAGGTTTGCAAGAGGCTTTAG ATGGCAGATTCAGAAGGGACCAGAGGGGAATGCGAACGAATCTTCAAACGGTTCGACAGCGACGGCGACGGGAAGATCTCGCTGTCGGAGCTGGAGAGTGCTCTTCGTGCCCTTGGCTCCTCCTCGCCGGAAGAGGTCCGACGACGGATGTCGGAAATCGATAAGGATGGCAATGGCTTCATTTCACTTGATGAACTCTGTGACTTTCAAAGGGCCAATCCTGATTTGATGAAGGAGGTTTGCAAGAGGCTTTAG ATGGCAGATTCAGAAGGGACCAGAGGGGAATGCGAACGAATCTTCAAACGGTTCGACAGCGACGGCGACGGGAAGATCTCGCTGTCGGAGCTGGAGAGTGCTCTTCGTGCCCTTGGCTCCTCCTCGCCGGAAGAGGTCCGACGACGGATGTCGGAAATCGATAAGGATGGCAATGGCTTCATTTCACTTGATGAACTCTGTGACTTTCAAAGGGCCAATCCTGATTTGATGAAGGAGGTTTGCAAGAGGCTTTAG MADSEGTRGECERIFKRFDSDGDGKISLSELESALRALGSSSPEEVRRRMSEIDKDGNGFISLDELCDFQRANPDLMKEVCKRL
BLAST of Bhi04G001664 vs. Swiss-Prot
Match: sp|P69197|POLC1_BRACM (Polcalcin Bra r 1 OS=Brassica campestris OX=3711 PE=1 SV=1) HSP 1 Score: 57.8 bits (138), Expect = 6.9e-08 Identity = 57/82 (69.51%), Postives = 65/82 (79.27%), Query Frame = 0
BLAST of Bhi04G001664 vs. Swiss-Prot
Match: sp|P69196|POLC1_BRANA (Polcalcin Bra n 1 OS=Brassica napus OX=3708 PE=1 SV=1) HSP 1 Score: 57.8 bits (138), Expect = 6.9e-08 Identity = 57/82 (69.51%), Postives = 65/82 (79.27%), Query Frame = 0
BLAST of Bhi04G001664 vs. Swiss-Prot
Match: sp|P94092|POLC7_CYNDA (Polcalcin Cyn d 7 OS=Cynodon dactylon OX=28909 PE=1 SV=2) HSP 1 Score: 57.8 bits (138), Expect = 6.9e-08 Identity = 35/82 (42.68%), Postives = 43/82 (52.44%), Query Frame = 0
BLAST of Bhi04G001664 vs. Swiss-Prot
Match: sp|O82040|POLC7_PHLPR (Polcalcin Phl p 7 OS=Phleum pratense OX=15957 PE=1 SV=1) HSP 1 Score: 57.0 bits (136), Expect = 1.2e-07 Identity = 55/73 (75.34%), Postives = 60/73 (82.19%), Query Frame = 0
BLAST of Bhi04G001664 vs. Swiss-Prot
Match: sp|O81092|ALL3_OLEEU (Polcalcin Ole e 3 OS=Olea europaea OX=4146 GN=OLE3 PE=1 SV=1) HSP 1 Score: 52.8 bits (125), Expect = 2.2e-06 Identity = 33/82 (40.24%), Postives = 39/82 (47.56%), Query Frame = 0
BLAST of Bhi04G001664 vs. TAIR10
Match: AT5G17480.1 (pollen calcium-binding protein 1) HSP 1 Score: 50.1 bits (118), Expect = 7.9e-07 Identity = 31/82 (37.80%), Postives = 42/82 (51.22%), Query Frame = 0
BLAST of Bhi04G001664 vs. TAIR10
Match: AT3G03430.1 (Calcium-binding EF-hand family protein) HSP 1 Score: 47.4 bits (111), Expect = 5.1e-06 Identity = 31/82 (37.80%), Postives = 41/82 (50.00%), Query Frame = 0
BLAST of Bhi04G001664 vs. TAIR10
Match: AT5G37770.1 (EF hand calcium-binding protein family) HSP 1 Score: 42.4 bits (98), Expect = 1.7e-04 Identity = 19/40 (47.50%), Postives = 31/40 (77.50%), Query Frame = 0
BLAST of Bhi04G001664 vs. TAIR10
Match: AT4G12860.1 (EF hand calcium-binding protein family) HSP 1 Score: 40.0 bits (92), Expect = 8.2e-04 Identity = 17/37 (45.95%), Postives = 26/37 (70.27%), Query Frame = 0
BLAST of Bhi04G001664 vs. TrEMBL
Match: tr|A0A0A0KAW9|A0A0A0KAW9_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_6G041150 PE=4 SV=1) HSP 1 Score: 90.1 bits (222), Expect = 2.5e-15 Identity = 49/84 (58.33%), Postives = 53/84 (63.10%), Query Frame = 0
BLAST of Bhi04G001664 vs. TrEMBL
Match: tr|A0A1S3BDB5|A0A1S3BDB5_CUCME (polcalcin Syr v 3-like OS=Cucumis melo OX=3656 GN=LOC103488650 PE=4 SV=1) HSP 1 Score: 84.3 bits (207), Expect = 1.4e-13 Identity = 48/84 (57.14%), Postives = 53/84 (63.10%), Query Frame = 0
BLAST of Bhi04G001664 vs. TrEMBL
Match: tr|M5X4D6|M5X4D6_PRUPE (Uncharacterized protein OS=Prunus persica OX=3760 GN=PRUPE_ppa019115mg PE=4 SV=1) HSP 1 Score: 72.0 bits (175), Expect = 7.1e-10 Identity = 42/84 (50.00%), Postives = 47/84 (55.95%), Query Frame = 0
BLAST of Bhi04G001664 vs. TrEMBL
Match: tr|A0A2P6Q6Y0|A0A2P6Q6Y0_ROSCH (Putative EF-hand domain pair protein OS=Rosa chinensis OX=74649 GN=RchiOBHm_Chr5g0019281 PE=4 SV=1) HSP 1 Score: 69.3 bits (168), Expect = 4.6e-09 Identity = 38/84 (45.24%), Postives = 45/84 (53.57%), Query Frame = 0
BLAST of Bhi04G001664 vs. TrEMBL
Match: tr|A0A2N9EHY0|A0A2N9EHY0_FAGSY (Uncharacterized protein OS=Fagus sylvatica OX=28930 GN=FSB_LOCUS2183 PE=4 SV=1) HSP 1 Score: 68.2 bits (165), Expect = 1.0e-08 Identity = 41/77 (53.25%), Postives = 48/77 (62.34%), Query Frame = 0
BLAST of Bhi04G001664 vs. NCBI nr
Match: KGN45979.1 (hypothetical protein Csa_6G041150 [Cucumis sativus]) HSP 1 Score: 90.1 bits (222), Expect = 3.8e-15 Identity = 49/84 (58.33%), Postives = 53/84 (63.10%), Query Frame = 0
BLAST of Bhi04G001664 vs. NCBI nr
Match: XP_022929895.1 (polcalcin Phl p 7-like [Cucurbita moschata]) HSP 1 Score: 87.8 bits (216), Expect = 1.9e-14 Identity = 48/84 (57.14%), Postives = 51/84 (60.71%), Query Frame = 0
BLAST of Bhi04G001664 vs. NCBI nr
Match: XP_022992461.1 (polcalcin Phl p 7-like [Cucurbita maxima]) HSP 1 Score: 87.8 bits (216), Expect = 1.9e-14 Identity = 48/84 (57.14%), Postives = 51/84 (60.71%), Query Frame = 0
BLAST of Bhi04G001664 vs. NCBI nr
Match: XP_023549323.1 (polcalcin Phl p 7-like [Cucurbita pepo subsp. pepo]) HSP 1 Score: 86.7 bits (213), Expect = 4.2e-14 Identity = 47/84 (55.95%), Postives = 51/84 (60.71%), Query Frame = 0
BLAST of Bhi04G001664 vs. NCBI nr
Match: XP_022150429.1 (polcalcin Syr v 3-like [Momordica charantia]) HSP 1 Score: 85.9 bits (211), Expect = 7.2e-14 Identity = 70/84 (83.33%), Postives = 72/84 (85.71%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of wax gourd
Date Performed: 2019-11-17
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene: |