Bhi03G000608 (gene) Wax gourd
The following sequences are available for this feature:
Legend: polypeptideexonCDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGTTTACTTCCATTGTCGATAATGTATTTGGATTCAAGGCTCTACATGCTCTACGTCTGGAGGATTTGCGAATCCCTATTGCTTATATTAAAACTTTCCAAGGCCCGCCTCATGGTATCCAGGTTGAAAGAGATAAATTGAACAAGTATGGTCGCCCTCTATTGGGATGTACTATTAAACCAAAATTGGGATTATTCGCTAAGAATTATGGTAGAGTAGTTTATGAATGTCTATGCGATGGACTTGATTGTACCAAAGATGATGAAAACGTGAATTCCCAACTATTTATGCGTTGGAGAGACCGTTTCCTATTTTGTGCGGAAGCTATTTATAAATCACAGGCTGAAACAGGTGAAATCAAGGGGCATTACTTGAATCCTACTCAGATACATGTGAAGAAATGA ATGTTTACTTCCATTGTCGATAATGTATTTGGATTCAAGGCTCTACATGCTCTACGTCTGGAGGATTTGCGAATCCCTATTGCTTATATTAAAACTTTCCAAGGCCCGCCTCATGGTATCCAGGTTGAAAGAGATAAATTGAACAAGTATGGTCGCCCTCTATTGGGATGTACTATTAAACCAAAATTGGGATTATTCGCTAAGAATTATGGTAGAGTAGTTTATGAATGTCTATGCGATGGACTTGATTGTACCAAAGATGATGAAAACGTGAATTCCCAACTATTTATGCGTTGGAGAGACCGTTTCCTATTTTGTGCGGAAGCTATTTATAAATCACAGGCTGAAACAGGTGAAATCAAGGGGCATTACTTGAATCCTACTCAGATACATGTGAAGAAATGA ATGTTTACTTCCATTGTCGATAATGTATTTGGATTCAAGGCTCTACATGCTCTACGTCTGGAGGATTTGCGAATCCCTATTGCTTATATTAAAACTTTCCAAGGCCCGCCTCATGGTATCCAGGTTGAAAGAGATAAATTGAACAAGTATGGTCGCCCTCTATTGGGATGTACTATTAAACCAAAATTGGGATTATTCGCTAAGAATTATGGTAGAGTAGTTTATGAATGTCTATGCGATGGACTTGATTGTACCAAAGATGATGAAAACGTGAATTCCCAACTATTTATGCGTTGGAGAGACCGTTTCCTATTTTGTGCGGAAGCTATTTATAAATCACAGGCTGAAACAGGTGAAATCAAGGGGCATTACTTGAATCCTACTCAGATACATGTGAAGAAATGA MFTSIVDNVFGFKALHALRLEDLRIPIAYIKTFQGPPHGIQVERDKLNKYGRPLLGCTIKPKLGLFAKNYGRVVYECLCDGLDCTKDDENVNSQLFMRWRDRFLFCAEAIYKSQAETGEIKGHYLNPTQIHVKK
BLAST of Bhi03G000608 vs. Swiss-Prot
Match: sp|Q31809|RBL_ASPLA (Ribulose bisphosphate carboxylase large chain (Fragment) OS=Asperula laevigata OX=29781 GN=rbcL PE=3 SV=1) HSP 1 Score: 250.4 bits (638), Expect = 1.2e-65 Identity = 117/128 (91.41%), Postives = 119/128 (92.97%), Query Frame = 0
BLAST of Bhi03G000608 vs. Swiss-Prot
Match: sp|P28395|RBL_CRAMA (Ribulose bisphosphate carboxylase large chain (Fragment) OS=Crassula marnierana OX=45093 GN=rbcL PE=3 SV=1) HSP 1 Score: 250.4 bits (638), Expect = 1.2e-65 Identity = 117/128 (91.41%), Postives = 119/128 (92.97%), Query Frame = 0
BLAST of Bhi03G000608 vs. Swiss-Prot
Match: sp|Q31946|RBL_CRUAN (Ribulose bisphosphate carboxylase large chain (Fragment) OS=Crucianella angustifolia OX=29784 GN=rbcL PE=3 SV=1) HSP 1 Score: 250.4 bits (638), Expect = 1.2e-65 Identity = 117/128 (91.41%), Postives = 119/128 (92.97%), Query Frame = 0
BLAST of Bhi03G000608 vs. Swiss-Prot
Match: sp|Q31992|RBL_CRUGL (Ribulose bisphosphate carboxylase large chain (Fragment) OS=Cruciata glabra OX=29785 GN=rbcL PE=3 SV=1) HSP 1 Score: 250.4 bits (638), Expect = 1.2e-65 Identity = 117/128 (91.41%), Postives = 119/128 (92.97%), Query Frame = 0
BLAST of Bhi03G000608 vs. Swiss-Prot
Match: sp|Q32255|RBL_GALAL (Ribulose bisphosphate carboxylase large chain (Fragment) OS=Galium album OX=29787 GN=rbcL PE=3 SV=1) HSP 1 Score: 250.4 bits (638), Expect = 1.2e-65 Identity = 117/128 (91.41%), Postives = 119/128 (92.97%), Query Frame = 0
BLAST of Bhi03G000608 vs. TAIR10
Match: ATCG00490.1 (ribulose-bisphosphate carboxylases) HSP 1 Score: 245.7 bits (626), Expect = 1.6e-65 Identity = 117/128 (91.41%), Postives = 117/128 (91.41%), Query Frame = 0
BLAST of Bhi03G000608 vs. TAIR10
Match: AT2G07732.1 (Ribulose bisphosphate carboxylase large chain, catalytic domain) HSP 1 Score: 114.8 bits (286), Expect = 4.2e-26 Identity = 52/62 (83.87%), Postives = 54/62 (87.10%), Query Frame = 0
BLAST of Bhi03G000608 vs. TAIR10
Match: ATMG00280.1 (Ribulose bisphosphate carboxylase large chain, catalytic domain) HSP 1 Score: 114.8 bits (286), Expect = 4.2e-26 Identity = 52/62 (83.87%), Postives = 54/62 (87.10%), Query Frame = 0
BLAST of Bhi03G000608 vs. TrEMBL
Match: tr|G0WYL0|G0WYL0_9ASTR (Ribulose bisphosphate carboxylase large chain (Fragment) OS=Gamochaeta pensylvanica OX=125697 GN=rbcL PE=3 SV=1) HSP 1 Score: 251.9 bits (642), Expect = 8.0e-64 Identity = 118/128 (92.19%), Postives = 119/128 (92.97%), Query Frame = 0
BLAST of Bhi03G000608 vs. TrEMBL
Match: tr|W5XN02|W5XN02_9ASTE (Ribulose bisphosphate carboxylase large chain (Fragment) OS=Heliotropium erosum OX=244098 GN=rbcL PE=3 SV=1) HSP 1 Score: 251.5 bits (641), Expect = 1.0e-63 Identity = 118/131 (90.08%), Postives = 120/131 (91.60%), Query Frame = 0
BLAST of Bhi03G000608 vs. TrEMBL
Match: tr|A0A1B2YKT6|A0A1B2YKT6_9ASTE (Ribulose bisphosphate carboxylase large chain (Fragment) OS=Heliotropium crispum OX=1891217 GN=rbcL PE=3 SV=1) HSP 1 Score: 251.5 bits (641), Expect = 1.0e-63 Identity = 118/131 (90.08%), Postives = 120/131 (91.60%), Query Frame = 0
BLAST of Bhi03G000608 vs. TrEMBL
Match: tr|A0A288QNM3|A0A288QNM3_9ASTE (Ribulose bisphosphate carboxylase large chain (Fragment) OS=Heliotropium bacciferum OX=244092 PE=3 SV=1) HSP 1 Score: 251.5 bits (641), Expect = 1.0e-63 Identity = 118/131 (90.08%), Postives = 120/131 (91.60%), Query Frame = 0
BLAST of Bhi03G000608 vs. TrEMBL
Match: tr|A0A288Q0C1|A0A288Q0C1_9ASTE (Ribulose bisphosphate carboxylase large chain (Fragment) OS=Heliotropium bacciferum OX=244092 PE=3 SV=1) HSP 1 Score: 251.5 bits (641), Expect = 1.0e-63 Identity = 118/131 (90.08%), Postives = 120/131 (91.60%), Query Frame = 0
BLAST of Bhi03G000608 vs. NCBI nr
Match: AEK34134.1 (ribulose-1,5-bisphosphate carboxylase/oxygenase large subunit, partial (chloroplast) [Gamochaeta pensylvanica]) HSP 1 Score: 251.9 bits (642), Expect = 1.2e-63 Identity = 118/128 (92.19%), Postives = 119/128 (92.97%), Query Frame = 0
BLAST of Bhi03G000608 vs. NCBI nr
Match: AOD75003.1 (ribulose-1,5-bisphosphate carboxylase/oxygenase large subunit, partial (chloroplast) [Heliotropium crispum]) HSP 1 Score: 251.5 bits (641), Expect = 1.6e-63 Identity = 118/131 (90.08%), Postives = 120/131 (91.60%), Query Frame = 0
BLAST of Bhi03G000608 vs. NCBI nr
Match: AOS58437.1 (ribulose-1,5-bisphosphate carboxylase/oxygenase large subunit, partial (chloroplast) [Heliotropium bacciferum]) HSP 1 Score: 251.5 bits (641), Expect = 1.6e-63 Identity = 118/131 (90.08%), Postives = 120/131 (91.60%), Query Frame = 0
BLAST of Bhi03G000608 vs. NCBI nr
Match: AOS58438.1 (ribulose-1,5-bisphosphate carboxylase/oxygenase large subunit, partial (chloroplast) [Heliotropium bacciferum]) HSP 1 Score: 251.5 bits (641), Expect = 1.6e-63 Identity = 118/131 (90.08%), Postives = 120/131 (91.60%), Query Frame = 0
BLAST of Bhi03G000608 vs. NCBI nr
Match: AHI17658.1 (ribulose-1,5-bisphosphate carboxylase/oxygenase large subunit, partial (chloroplast) [Heliotropium erosum]) HSP 1 Score: 251.5 bits (641), Expect = 1.6e-63 Identity = 118/131 (90.08%), Postives = 120/131 (91.60%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of wax gourd
Date Performed: 2019-11-17
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene: |