Bhi02G001131 (gene) Wax gourd
The following sequences are available for this feature:
Legend: polypeptideexonCDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGAAGAATGCTGAAGACAAGGATAAAAATGCTCGAGAATATGTTGAAAATTTGAAAAAACGATGGGAAATAGGAGTCTATACCCTTTGTTTGATTTATAATGCCACTGGTGATACCATAAAATATGTTTGCGAACACAATTGGCATGGACATATCGGACCTGGTCCTTACCCAATTGAGATAGCAAATGGATAA ATGAAGAATGCTGAAGACAAGGATAAAAATGCTCGAGAATATGTTGAAAATTTGAAAAAACGATGGGAAATAGGAGTCTATACCCTTTGTTTGATTTATAATGCCACTGGTGATACCATAAAATATGTTTGCGAACACAATTGGCATGGACATATCGGACCTGGTCCTTACCCAATTGAGATAGCAAATGGATAA ATGAAGAATGCTGAAGACAAGGATAAAAATGCTCGAGAATATGTTGAAAATTTGAAAAAACGATGGGAAATAGGAGTCTATACCCTTTGTTTGATTTATAATGCCACTGGTGATACCATAAAATATGTTTGCGAACACAATTGGCATGGACATATCGGACCTGGTCCTTACCCAATTGAGATAGCAAATGGATAA MKNAEDKDKNAREYVENLKKRWEIGVYTLCLIYNATGDTIKYVCEHNWHGHIGPGPYPIEIANG
BLAST of Bhi02G001131 vs. Swiss-Prot
Match: sp|P32024|JI23_HORVU (23 kDa jasmonate-induced protein OS=Hordeum vulgare OX=4513 PE=2 SV=1) HSP 1 Score: 72.8 bits (177), Expect = 1.6e-12 Identity = 32/64 (50.00%), Postives = 45/64 (70.31%), Query Frame = 0
BLAST of Bhi02G001131 vs. TrEMBL
Match: tr|A0A097BU21|A0A097BU21_CITLA (23 kDa jasmonate-induced protein OS=Citrullus lanatus OX=3654 PE=2 SV=1) HSP 1 Score: 122.9 bits (307), Expect = 2.7e-25 Identity = 54/64 (84.38%), Postives = 59/64 (92.19%), Query Frame = 0
BLAST of Bhi02G001131 vs. TrEMBL
Match: tr|A0A1S3B9I3|A0A1S3B9I3_CUCME (23 kDa jasmonate-induced protein-like OS=Cucumis melo OX=3656 GN=LOC103487248 PE=4 SV=1) HSP 1 Score: 108.6 bits (270), Expect = 5.2e-21 Identity = 46/64 (71.88%), Postives = 56/64 (87.50%), Query Frame = 0
BLAST of Bhi02G001131 vs. TrEMBL
Match: tr|A0A0A0M0F4|A0A0A0M0F4_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_1G642550 PE=4 SV=1) HSP 1 Score: 108.6 bits (270), Expect = 5.2e-21 Identity = 46/64 (71.88%), Postives = 55/64 (85.94%), Query Frame = 0
BLAST of Bhi02G001131 vs. TrEMBL
Match: tr|M5XVI7|M5XVI7_PRUPE (Uncharacterized protein (Fragment) OS=Prunus persica OX=3760 GN=PRUPE_ppa022968mg PE=4 SV=1) HSP 1 Score: 91.3 bits (225), Expect = 8.6e-16 Identity = 42/64 (65.62%), Postives = 50/64 (78.12%), Query Frame = 0
BLAST of Bhi02G001131 vs. TrEMBL
Match: tr|A0A251RJQ0|A0A251RJQ0_PRUPE (Uncharacterized protein OS=Prunus persica OX=3760 GN=PRUPE_1G577300 PE=4 SV=1) HSP 1 Score: 91.3 bits (225), Expect = 8.6e-16 Identity = 42/64 (65.62%), Postives = 50/64 (78.12%), Query Frame = 0
BLAST of Bhi02G001131 vs. NCBI nr
Match: AIS71930.1 (23 kDa jasmonate-induced protein [Citrullus lanatus]) HSP 1 Score: 122.9 bits (307), Expect = 4.0e-25 Identity = 54/64 (84.38%), Postives = 59/64 (92.19%), Query Frame = 0
BLAST of Bhi02G001131 vs. NCBI nr
Match: XP_022157068.1 (23 kDa jasmonate-induced protein-like [Momordica charantia] >XP_022157069.1 23 kDa jasmonate-induced protein-like [Momordica charantia]) HSP 1 Score: 112.1 bits (279), Expect = 7.1e-22 Identity = 47/62 (75.81%), Postives = 53/62 (85.48%), Query Frame = 0
BLAST of Bhi02G001131 vs. NCBI nr
Match: KGN66612.1 (hypothetical protein Csa_1G642550 [Cucumis sativus]) HSP 1 Score: 108.6 bits (270), Expect = 7.9e-21 Identity = 46/64 (71.88%), Postives = 55/64 (85.94%), Query Frame = 0
BLAST of Bhi02G001131 vs. NCBI nr
Match: XP_008443732.1 (PREDICTED: 23 kDa jasmonate-induced protein-like [Cucumis melo]) HSP 1 Score: 108.6 bits (270), Expect = 7.9e-21 Identity = 46/64 (71.88%), Postives = 56/64 (87.50%), Query Frame = 0
BLAST of Bhi02G001131 vs. NCBI nr
Match: XP_004139150.2 (PREDICTED: 23 kDa jasmonate-induced protein-like [Cucumis sativus]) HSP 1 Score: 108.6 bits (270), Expect = 7.9e-21 Identity = 46/64 (71.88%), Postives = 55/64 (85.94%), Query Frame = 0
The following BLAST results are available for this feature:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of wax gourd
Date Performed: 2019-11-17
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|