Bhi02G001064 (gene) Wax gourd
The following sequences are available for this feature:
Legend: polypeptideexonCDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGAAAGAAGGCGAGGAAGAGACTACTGAGTTCGTCACTCCAGGTGAAGTTCTCGGAATCTTTTCCGACTTCAGACCTGGAAGAGGCGCTTATGTCTTCAACAACACTGTTTATGCTTCTCTTTCTGGTTTCCGCCGCACTATTCCTCCTCCCACCGACTCTTCGGATCTAGTACAACTCTTTTTCTTCACTCTTTCTGTTTTTTGCTTCATCTTTTGA ATGAAAGAAGGCGAGGAAGAGACTACTGAGTTCGTCACTCCAGGTGAAGTTCTCGGAATCTTTTCCGACTTCAGACCTGGAAGAGGCGCTTATGTCTTCAACAACACTGTTTATGCTTCTCTTTCTGGTTTCCGCCGCACTATTCCTCCTCCCACCGACTCTTCGGATCTAGTACAACTCTTTTTCTTCACTCTTTCTGTTTTTTGCTTCATCTTTTGA ATGAAAGAAGGCGAGGAAGAGACTACTGAGTTCGTCACTCCAGGTGAAGTTCTCGGAATCTTTTCCGACTTCAGACCTGGAAGAGGCGCTTATGTCTTCAACAACACTGTTTATGCTTCTCTTTCTGGTTTCCGCCGCACTATTCCTCCTCCCACCGACTCTTCGGATCTAGTACAACTCTTTTTCTTCACTCTTTCTGTTTTTTGCTTCATCTTTTGA MKEGEEETTEFVTPGEVLGIFSDFRPGRGAYVFNNTVYASLSGFRRTIPPPTDSSDLVQLFFFTLSVFCFIF
BLAST of Bhi02G001064 vs. TAIR10
Match: AT5G38890.1 (Nucleic acid-binding, OB-fold-like protein) HSP 1 Score: 53.5 bits (127), Expect = 6.2e-08 Identity = 24/49 (48.98%), Postives = 35/49 (71.43%), Query Frame = 0
BLAST of Bhi02G001064 vs. TrEMBL
Match: tr|A0A1S3CMV8|A0A1S3CMV8_CUCME (exosome complex component CSL4 OS=Cucumis melo OX=3656 GN=LOC103502755 PE=4 SV=1) HSP 1 Score: 99.8 bits (247), Expect = 2.7e-18 Identity = 48/57 (84.21%), Postives = 53/57 (92.98%), Query Frame = 0
BLAST of Bhi02G001064 vs. TrEMBL
Match: tr|A0A0A0L935|A0A0A0L935_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_3G627150 PE=4 SV=1) HSP 1 Score: 95.5 bits (236), Expect = 5.2e-17 Identity = 47/57 (82.46%), Postives = 52/57 (91.23%), Query Frame = 0
BLAST of Bhi02G001064 vs. TrEMBL
Match: tr|A0A1S3V5W2|A0A1S3V5W2_VIGRR (exosome complex component CSL4 OS=Vigna radiata var. radiata OX=3916 GN=LOC106772089 PE=4 SV=1) HSP 1 Score: 73.6 bits (179), Expect = 2.1e-10 Identity = 37/54 (68.52%), Postives = 40/54 (74.07%), Query Frame = 0
BLAST of Bhi02G001064 vs. TrEMBL
Match: tr|A0A0L9THS3|A0A0L9THS3_PHAAN (Uncharacterized protein OS=Phaseolus angularis OX=3914 GN=LR48_Vigan845s003900 PE=4 SV=1) HSP 1 Score: 72.0 bits (175), Expect = 6.1e-10 Identity = 36/54 (66.67%), Postives = 39/54 (72.22%), Query Frame = 0
BLAST of Bhi02G001064 vs. TrEMBL
Match: tr|A0A0S3SQ27|A0A0S3SQ27_PHAAN (Uncharacterized protein OS=Vigna angularis var. angularis OX=157739 GN=Vigan.08G157100 PE=4 SV=1) HSP 1 Score: 72.0 bits (175), Expect = 6.1e-10 Identity = 36/54 (66.67%), Postives = 39/54 (72.22%), Query Frame = 0
BLAST of Bhi02G001064 vs. NCBI nr
Match: XP_008465048.1 (PREDICTED: exosome complex component CSL4 [Cucumis melo]) HSP 1 Score: 99.8 bits (247), Expect = 4.1e-18 Identity = 48/57 (84.21%), Postives = 53/57 (92.98%), Query Frame = 0
BLAST of Bhi02G001064 vs. NCBI nr
Match: XP_022934020.1 (exosome complex component CSL4 [Cucurbita moschata]) HSP 1 Score: 97.4 bits (241), Expect = 2.0e-17 Identity = 48/56 (85.71%), Postives = 50/56 (89.29%), Query Frame = 0
BLAST of Bhi02G001064 vs. NCBI nr
Match: XP_023530831.1 (exosome complex component CSL4 [Cucurbita pepo subsp. pepo]) HSP 1 Score: 97.4 bits (241), Expect = 2.0e-17 Identity = 48/56 (85.71%), Postives = 50/56 (89.29%), Query Frame = 0
BLAST of Bhi02G001064 vs. NCBI nr
Match: XP_004144376.1 (PREDICTED: exosome complex component CSL4 [Cucumis sativus] >KGN58353.1 hypothetical protein Csa_3G627150 [Cucumis sativus]) HSP 1 Score: 95.5 bits (236), Expect = 7.8e-17 Identity = 47/57 (82.46%), Postives = 52/57 (91.23%), Query Frame = 0
BLAST of Bhi02G001064 vs. NCBI nr
Match: XP_022974279.1 (exosome complex component CSL4 [Cucurbita maxima]) HSP 1 Score: 94.7 bits (234), Expect = 1.3e-16 Identity = 47/56 (83.93%), Postives = 49/56 (87.50%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of wax gourd
Date Performed: 2019-11-17
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|