Bhi01G001219 (gene) Wax gourd
The following sequences are available for this feature:
Legend: polypeptideexonCDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGTACGTCGCTGAGCCGTCCGATCAACTGATCTATGTGGCTAAAGGATCGGGGAAGATTCAAATCGTCGGATTTTCGAGTAAAATTAATGTAGAGGTGAAAATGGGTCAGCTGATTTTGGTCCCCAGATACTTCGCCGTCGGGAAGATCGCCGGAGAAGAAGGCTTGGAGTGTATTTCCATGATCACAGATACTCAGTAATGAAAAGCTTCAACTTTTTTTTTTAATTATTTTTTTATTTGGGTTTATTCTGAATATTAAAAATTAACATCTCTGATATTAAATTGAACAGTCCTTTGGTGGAAGAATTGGCCGGAAAGACGTCGGTTTTGGAGGCATTGTCGCCGGAGGTTTTTCAAGTTTCTTACAACGTCACGGCGAAGTTCGAGGAGCTCTTTAGGTCGAAGGTTTAA ATGTACGTCGCTGAGCCGTCCGATCAACTGATCTATGTGGCTAAAGGATCGGGGAAGATTCAAATCGTCGGATTTTCGAGTAAAATTAATGTAGAGGTGAAAATGGGTCAGCTGATTTTGGTCCCCAGATACTTCGCCGTCGGGAAGATCGCCGGAGAAGAAGGCTTGGAGTGTATTTCCATGATCACAGATACTCATCCTTTGGTGGAAGAATTGGCCGGAAAGACGTCGGTTTTGGAGGCATTGTCGCCGGAGGTTTTTCAAGTTTCTTACAACGTCACGGCGAAGTTCGAGGAGCTCTTTAGGTCGAAGGTTTAA ATGTACGTCGCTGAGCCGTCCGATCAACTGATCTATGTGGCTAAAGGATCGGGGAAGATTCAAATCGTCGGATTTTCGAGTAAAATTAATGTAGAGGTGAAAATGGGTCAGCTGATTTTGGTCCCCAGATACTTCGCCGTCGGGAAGATCGCCGGAGAAGAAGGCTTGGAGTGTATTTCCATGATCACAGATACTCATCCTTTGGTGGAAGAATTGGCCGGAAAGACGTCGGTTTTGGAGGCATTGTCGCCGGAGGTTTTTCAAGTTTCTTACAACGTCACGGCGAAGTTCGAGGAGCTCTTTAGGTCGAAGGTTTAA MYVAEPSDQLIYVAKGSGKIQIVGFSSKINVEVKMGQLILVPRYFAVGKIAGEEGLECISMITDTHPLVEELAGKTSVLEALSPEVFQVSYNVTAKFEELFRSKV
BLAST of Bhi01G001219 vs. TAIR10
Match: AT2G28680.1 (RmlC-like cupins superfamily protein) HSP 1 Score: 90.5 bits (223), Expect = 6.6e-19 Identity = 46/98 (46.94%), Postives = 63/98 (64.29%), Query Frame = 0
BLAST of Bhi01G001219 vs. TAIR10
Match: AT1G07750.1 (RmlC-like cupins superfamily protein) HSP 1 Score: 85.1 bits (209), Expect = 2.8e-17 Identity = 41/97 (42.27%), Postives = 61/97 (62.89%), Query Frame = 0
BLAST of Bhi01G001219 vs. TAIR10
Match: AT1G03890.1 (RmlC-like cupins superfamily protein) HSP 1 Score: 65.9 bits (159), Expect = 1.7e-11 Identity = 36/86 (41.86%), Postives = 52/86 (60.47%), Query Frame = 0
BLAST of Bhi01G001219 vs. TAIR10
Match: AT4G28520.1 (cruciferin 3) HSP 1 Score: 51.6 bits (122), Expect = 3.4e-07 Identity = 27/90 (30.00%), Postives = 54/90 (60.00%), Query Frame = 0
BLAST of Bhi01G001219 vs. TAIR10
Match: AT1G03880.1 (cruciferin 2) HSP 1 Score: 50.4 bits (119), Expect = 7.6e-07 Identity = 31/86 (36.05%), Postives = 47/86 (54.65%), Query Frame = 0
BLAST of Bhi01G001219 vs. Swiss-Prot
Match: sp|O23878|13S1_FAGES (13S globulin seed storage protein 1 OS=Fagopyrum esculentum OX=3617 GN=FA02 PE=2 SV=1) HSP 1 Score: 71.2 bits (173), Expect = 7.5e-12 Identity = 40/96 (41.67%), Postives = 60/96 (62.50%), Query Frame = 0
BLAST of Bhi01G001219 vs. Swiss-Prot
Match: sp|Q9XFM4|13S3_FAGES (13S globulin seed storage protein 3 OS=Fagopyrum esculentum OX=3617 GN=FAGAG1 PE=1 SV=1) HSP 1 Score: 71.2 bits (173), Expect = 7.5e-12 Identity = 40/96 (41.67%), Postives = 60/96 (62.50%), Query Frame = 0
BLAST of Bhi01G001219 vs. Swiss-Prot
Match: sp|P83004|13SB_FAGES (13S globulin basic chain OS=Fagopyrum esculentum OX=3617 PE=1 SV=1) HSP 1 Score: 69.3 bits (168), Expect = 2.9e-11 Identity = 34/91 (37.36%), Postives = 57/91 (62.64%), Query Frame = 0
BLAST of Bhi01G001219 vs. Swiss-Prot
Match: sp|Q9ZWA9|CRU4_ARATH (12S seed storage protein CRD OS=Arabidopsis thaliana OX=3702 GN=CRD PE=1 SV=1) HSP 1 Score: 65.9 bits (159), Expect = 3.2e-10 Identity = 36/86 (41.86%), Postives = 52/86 (60.47%), Query Frame = 0
BLAST of Bhi01G001219 vs. Swiss-Prot
Match: sp|P07728|GLUA1_ORYSJ (Glutelin type-A 1 OS=Oryza sativa subsp. japonica OX=39947 GN=GLUA1 PE=1 SV=2) HSP 1 Score: 60.5 bits (145), Expect = 1.3e-08 Identity = 28/87 (32.18%), Postives = 55/87 (63.22%), Query Frame = 0
BLAST of Bhi01G001219 vs. TrEMBL
Match: tr|A0A0A0L6K0|A0A0A0L6K0_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_3G218160 PE=4 SV=1) HSP 1 Score: 178.7 bits (452), Expect = 6.7e-42 Identity = 89/105 (84.76%), Postives = 98/105 (93.33%), Query Frame = 0
BLAST of Bhi01G001219 vs. TrEMBL
Match: tr|A0A1S3C2D5|A0A1S3C2D5_CUCME (glutelin type-A 2-like OS=Cucumis melo OX=3656 GN=LOC103496119 PE=4 SV=1) HSP 1 Score: 178.3 bits (451), Expect = 8.8e-42 Identity = 88/105 (83.81%), Postives = 99/105 (94.29%), Query Frame = 0
BLAST of Bhi01G001219 vs. TrEMBL
Match: tr|A0A0A0LC21|A0A0A0LC21_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_3G218170 PE=4 SV=1) HSP 1 Score: 142.1 bits (357), Expect = 7.0e-31 Identity = 69/107 (64.49%), Postives = 88/107 (82.24%), Query Frame = 0
BLAST of Bhi01G001219 vs. TrEMBL
Match: tr|A0A1S3C332|A0A1S3C332_CUCME (glutelin type-B 5 OS=Cucumis melo OX=3656 GN=LOC103496120 PE=4 SV=1) HSP 1 Score: 139.0 bits (349), Expect = 5.9e-30 Identity = 70/107 (65.42%), Postives = 86/107 (80.37%), Query Frame = 0
BLAST of Bhi01G001219 vs. TrEMBL
Match: tr|A0A0A0K550|A0A0A0K550_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_7G337100 PE=4 SV=1) HSP 1 Score: 119.0 bits (297), Expect = 6.3e-24 Identity = 62/103 (60.19%), Postives = 79/103 (76.70%), Query Frame = 0
BLAST of Bhi01G001219 vs. NCBI nr
Match: XP_004151504.1 (PREDICTED: legumin J [Cucumis sativus] >KGN57580.1 hypothetical protein Csa_3G218160 [Cucumis sativus]) HSP 1 Score: 178.7 bits (452), Expect = 1.0e-41 Identity = 89/105 (84.76%), Postives = 98/105 (93.33%), Query Frame = 0
BLAST of Bhi01G001219 vs. NCBI nr
Match: XP_008456076.1 (PREDICTED: glutelin type-A 2-like [Cucumis melo]) HSP 1 Score: 178.3 bits (451), Expect = 1.3e-41 Identity = 88/105 (83.81%), Postives = 99/105 (94.29%), Query Frame = 0
BLAST of Bhi01G001219 vs. NCBI nr
Match: XP_022985328.1 (12S seed storage protein CRD-like [Cucurbita maxima]) HSP 1 Score: 178.3 bits (451), Expect = 1.3e-41 Identity = 89/105 (84.76%), Postives = 100/105 (95.24%), Query Frame = 0
BLAST of Bhi01G001219 vs. NCBI nr
Match: XP_022922755.1 (legumin J-like [Cucurbita moschata]) HSP 1 Score: 174.9 bits (442), Expect = 1.5e-40 Identity = 87/105 (82.86%), Postives = 99/105 (94.29%), Query Frame = 0
BLAST of Bhi01G001219 vs. NCBI nr
Match: XP_023552908.1 (12S seed storage globulin 1-like [Cucurbita pepo subsp. pepo]) HSP 1 Score: 173.7 bits (439), Expect = 3.3e-40 Identity = 87/105 (82.86%), Postives = 98/105 (93.33%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of wax gourd
Date Performed: 2019-11-17
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|