MELO3C010085 (gene) Melon (DHL92) v3.5.1
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.CTGCCGAAGCCGAGCTTTCTCTTGCGCAAGTAATTGTTGACAGTGCAGGGGTCATCGTTCAAAATGCAGATTTGACAATCTGTTACGATGAGAGAGGTCCATACATACCATTGCTTCATTTACAAAATTATGATATGTTATTTTTAGTTTAATCATCGAAATCAATCCTACCGCAGGAGCAAAATATGAACTCCCCAACTATGTTTTAAGTGAGCCGACCAACTTAATTCGTGACAGCTAA CTGCCGAAGCCGAGCTTTCTCTTGCGCAAGTAATTGTTGACAGTGCAGGGGTCATCGTTCAAAATGCAGATTTGACAATCTGTTACGATGAGAGAGGAGCAAAATATGAACTCCCCAACTATGTTTTAAGTGAGCCGACCAACTTAATTCGTGACAGCTAA CTGCCGAAGCCGAGCTTTCTCTTGCGCAAGTAATTGTTGACAGTGCAGGGGTCATCGTTCAAAATGCAGATTTGACAATCTGTTACGATGAGAGAGGAGCAAAATATGAACTCCCCAACTATGTTTTAAGTGAGCCGACCAACTTAATTCGTGACAGCTAA AEAELSLAQVIVDSAGVIVQNADLTICYDERGAKYELPNYVLSEPTNLIRDS*
BLAST of MELO3C010085 vs. Swiss-Prot
Match: UBTD1_XENTR (Ubiquitin domain-containing protein 1 OS=Xenopus tropicalis GN=ubtd1 PE=2 SV=1) HSP 1 Score: 51.6 bits (122), Expect = 3.1e-06 Identity = 23/45 (51.11%), Postives = 28/45 (62.22%), Query Frame = 1
BLAST of MELO3C010085 vs. Swiss-Prot
Match: UBTD1_DANRE (Ubiquitin domain-containing protein 1 OS=Danio rerio GN=ubtd1 PE=2 SV=1) HSP 1 Score: 50.8 bits (120), Expect = 5.2e-06 Identity = 23/45 (51.11%), Postives = 28/45 (62.22%), Query Frame = 1
BLAST of MELO3C010085 vs. Swiss-Prot
Match: UBTD2_DANRE (Ubiquitin domain-containing protein 2 OS=Danio rerio GN=ubtd2 PE=2 SV=1) HSP 1 Score: 50.4 bits (119), Expect = 6.8e-06 Identity = 22/45 (48.89%), Postives = 28/45 (62.22%), Query Frame = 1
BLAST of MELO3C010085 vs. TrEMBL
Match: A0A0A0KVJ9_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_4G083480 PE=4 SV=1) HSP 1 Score: 102.4 bits (254), Expect = 1.7e-19 Identity = 51/52 (98.08%), Postives = 51/52 (98.08%), Query Frame = 1
BLAST of MELO3C010085 vs. TrEMBL
Match: B9N8W8_POPTR (Uncharacterized protein OS=Populus trichocarpa GN=POPTR_0001s39570g PE=4 SV=1) HSP 1 Score: 96.7 bits (239), Expect = 9.2e-18 Identity = 46/52 (88.46%), Postives = 50/52 (96.15%), Query Frame = 1
BLAST of MELO3C010085 vs. TrEMBL
Match: A0A151S963_CAJCA (Ubiquitin domain-containing protein 1 OS=Cajanus cajan GN=KK1_026761 PE=4 SV=1) HSP 1 Score: 96.7 bits (239), Expect = 9.2e-18 Identity = 47/52 (90.38%), Postives = 50/52 (96.15%), Query Frame = 1
BLAST of MELO3C010085 vs. TrEMBL
Match: B9SEV6_RICCO (Ubiquitin domain-containing protein, putative OS=Ricinus communis GN=RCOM_0106280 PE=4 SV=1) HSP 1 Score: 96.3 bits (238), Expect = 1.2e-17 Identity = 48/50 (96.00%), Postives = 48/50 (96.00%), Query Frame = 1
BLAST of MELO3C010085 vs. TrEMBL
Match: A0A061FG33_THECC (Ubiquitin domain-containing protein OS=Theobroma cacao GN=TCM_032011 PE=4 SV=1) HSP 1 Score: 96.3 bits (238), Expect = 1.2e-17 Identity = 47/52 (90.38%), Postives = 50/52 (96.15%), Query Frame = 1
BLAST of MELO3C010085 vs. TAIR10
Match: AT1G53400.1 (AT1G53400.1 Ubiquitin domain-containing protein) HSP 1 Score: 89.0 bits (219), Expect = 9.7e-19 Identity = 42/48 (87.50%), Postives = 43/48 (89.58%), Query Frame = 1
BLAST of MELO3C010085 vs. TAIR10
Match: AT5G45740.1 (AT5G45740.1 Ubiquitin domain-containing protein) HSP 1 Score: 88.6 bits (218), Expect = 1.3e-18 Identity = 42/51 (82.35%), Postives = 45/51 (88.24%), Query Frame = 1
BLAST of MELO3C010085 vs. TAIR10
Match: AT1G16960.1 (AT1G16960.1 Ubiquitin domain-containing protein) HSP 1 Score: 78.2 bits (191), Expect = 1.7e-15 Identity = 36/48 (75.00%), Postives = 41/48 (85.42%), Query Frame = 1
BLAST of MELO3C010085 vs. NCBI nr
Match: gi|659101695|ref|XP_008451743.1| (PREDICTED: ubiquitin domain-containing protein 2-like [Cucumis melo]) HSP 1 Score: 104.0 bits (258), Expect = 8.3e-20 Identity = 52/52 (100.00%), Postives = 52/52 (100.00%), Query Frame = 1
BLAST of MELO3C010085 vs. NCBI nr
Match: gi|449438909|ref|XP_004137230.1| (PREDICTED: ubiquitin domain-containing protein 1-like [Cucumis sativus]) HSP 1 Score: 102.4 bits (254), Expect = 2.4e-19 Identity = 51/52 (98.08%), Postives = 51/52 (98.08%), Query Frame = 1
BLAST of MELO3C010085 vs. NCBI nr
Match: gi|566153708|ref|XP_006370109.1| (hypothetical protein POPTR_0001s39570g [Populus trichocarpa]) HSP 1 Score: 96.7 bits (239), Expect = 1.3e-17 Identity = 46/52 (88.46%), Postives = 50/52 (96.15%), Query Frame = 1
BLAST of MELO3C010085 vs. NCBI nr
Match: gi|743917531|ref|XP_011002754.1| (PREDICTED: ubiquitin domain-containing protein 1-like [Populus euphratica]) HSP 1 Score: 96.7 bits (239), Expect = 1.3e-17 Identity = 46/52 (88.46%), Postives = 50/52 (96.15%), Query Frame = 1
BLAST of MELO3C010085 vs. NCBI nr
Match: gi|1012340111|gb|KYP51332.1| (Ubiquitin domain-containing protein 1 [Cajanus cajan]) HSP 1 Score: 96.7 bits (239), Expect = 1.3e-17 Identity = 47/52 (90.38%), Postives = 50/52 (96.15%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of melon
Date Performed: 2016-09-28
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|