MELO3C026136 (gene) Melon (DHL92) v3.5.1
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGCTAAAGGGTTGGGTCTTGGTTGTACTTATGGCATTGCTTGTATGTCTTGGGCACTTGTTTTCTGGTATGCTGGTGTTTTCATCCGAAACGGACAAACAGACAGTGGTAAAGCCTTCACTGCTATATTCTCTGCCATCGTCGGTGGCATGTAAGACTCAAGAAATTAGAATCTTTGGTTTAACTAATTACATCAGGATTATAGTTTTTGTTGAACGTGGTTTTTGTGTAATGCTATAGGAGTTTGGGGCAGTCATTTTCCAATTTGGGAGCATTTAGTAAAGGGAAAGCAGCAGGGTATAAATCGATGGAGATTATCAAACAAAAGCCAACAATAATTCAAGACCCATTAGATGGGAAATGTTTGGGTGAAGTTCGAAACAAGCGTCACCCATGA ATGGCTAAAGGGTTGGGTCTTGGTTGTACTTATGGCATTGCTTGTATGTCTTGGGCACTTGTTTTCTGGTATGCTGGTGTTTTCATCCGAAACGGACAAACAGACAGTGGTAAAGCCTTCACTGCTATATTCTCTGCCATCGTCGGTGGCATGAGTTTGGGGCAGTCATTTTCCAATTTGGGAGCATTTAGTAAAGGGAAAGCAGCAGGGTATAAATCGATGGAGATTATCAAACAAAAGCCAACAATAATTCAAGACCCATTAGATGGGAAATGTTTGGGTGAAGTTCGAAACAAGCGTCACCCATGA ATGGCTAAAGGGTTGGGTCTTGGTTGTACTTATGGCATTGCTTGTATGTCTTGGGCACTTGTTTTCTGGTATGCTGGTGTTTTCATCCGAAACGGACAAACAGACAGTGGTAAAGCCTTCACTGCTATATTCTCTGCCATCGTCGGTGGCATGAGTTTGGGGCAGTCATTTTCCAATTTGGGAGCATTTAGTAAAGGGAAAGCAGCAGGGTATAAATCGATGGAGATTATCAAACAAAAGCCAACAATAATTCAAGACCCATTAGATGGGAAATGTTTGGGTGAAGTTCGAAACAAGCGTCACCCATGA MAKGLGLGCTYGIACMSWALVFWYAGVFIRNGQTDSGKAFTAIFSAIVGGMSLGQSFSNLGAFSKGKAAGYKSMEIIKQKPTIIQDPLDGKCLGEVRNKRHP*
BLAST of MELO3C026136 vs. Swiss-Prot
Match: AB19B_ARATH (ABC transporter B family member 19 OS=Arabidopsis thaliana GN=ABCB19 PE=1 SV=1) HSP 1 Score: 187.6 bits (475), Expect = 6.9e-47 Identity = 90/96 (93.75%), Postives = 90/96 (93.75%), Query Frame = 1
BLAST of MELO3C026136 vs. Swiss-Prot
Match: AB1B_ARATH (ABC transporter B family member 1 OS=Arabidopsis thaliana GN=ABCB1 PE=1 SV=1) HSP 1 Score: 80.9 bits (198), Expect = 9.1e-15 Identity = 39/96 (40.62%), Postives = 56/96 (58.33%), Query Frame = 1
BLAST of MELO3C026136 vs. Swiss-Prot
Match: AB14B_ARATH (ABC transporter B family member 14 OS=Arabidopsis thaliana GN=ABCB14 PE=3 SV=1) HSP 1 Score: 80.1 bits (196), Expect = 1.6e-14 Identity = 35/77 (45.45%), Postives = 50/77 (64.94%), Query Frame = 1
BLAST of MELO3C026136 vs. Swiss-Prot
Match: AB13B_ARATH (ABC transporter B family member 13 OS=Arabidopsis thaliana GN=ABCB13 PE=3 SV=1) HSP 1 Score: 75.9 bits (185), Expect = 2.9e-13 Identity = 33/77 (42.86%), Postives = 48/77 (62.34%), Query Frame = 1
BLAST of MELO3C026136 vs. Swiss-Prot
Match: AB2B_ARATH (ABC transporter B family member 2 OS=Arabidopsis thaliana GN=ABCB2 PE=1 SV=3) HSP 1 Score: 74.7 bits (182), Expect = 6.5e-13 Identity = 33/96 (34.38%), Postives = 54/96 (56.25%), Query Frame = 1
BLAST of MELO3C026136 vs. TrEMBL
Match: A0A0A0KVI9_CUCSA (Multidrug resistance protein 1, 2 OS=Cucumis sativus GN=Csa_5G636450 PE=4 SV=1) HSP 1 Score: 194.5 bits (493), Expect = 6.3e-47 Identity = 94/96 (97.92%), Postives = 94/96 (97.92%), Query Frame = 1
BLAST of MELO3C026136 vs. TrEMBL
Match: M5XII0_PRUPE (Uncharacterized protein OS=Prunus persica GN=PRUPE_ppa000359mg PE=4 SV=1) HSP 1 Score: 189.9 bits (481), Expect = 1.6e-45 Identity = 91/96 (94.79%), Postives = 93/96 (96.88%), Query Frame = 1
BLAST of MELO3C026136 vs. TrEMBL
Match: D7LM51_ARALL (P-glycoprotein 19 OS=Arabidopsis lyrata subsp. lyrata GN=ATMDR11 PE=4 SV=1) HSP 1 Score: 188.7 bits (478), Expect = 3.5e-45 Identity = 91/96 (94.79%), Postives = 92/96 (95.83%), Query Frame = 1
BLAST of MELO3C026136 vs. TrEMBL
Match: B9RUP8_RICCO (Multidrug resistance protein 1, 2, putative OS=Ricinus communis GN=RCOM_0855230 PE=4 SV=1) HSP 1 Score: 188.7 bits (478), Expect = 3.5e-45 Identity = 91/96 (94.79%), Postives = 92/96 (95.83%), Query Frame = 1
BLAST of MELO3C026136 vs. TrEMBL
Match: A0A151S7Z0_CAJCA (ABC transporter B family member 19 OS=Cajanus cajan GN=KK1_027316 PE=4 SV=1) HSP 1 Score: 188.3 bits (477), Expect = 4.5e-45 Identity = 90/96 (93.75%), Postives = 92/96 (95.83%), Query Frame = 1
BLAST of MELO3C026136 vs. TAIR10
Match: AT3G28860.1 (AT3G28860.1 ATP binding cassette subfamily B19) HSP 1 Score: 187.6 bits (475), Expect = 3.9e-48 Identity = 90/96 (93.75%), Postives = 90/96 (93.75%), Query Frame = 1
BLAST of MELO3C026136 vs. TAIR10
Match: AT2G36910.1 (AT2G36910.1 ATP binding cassette subfamily B1) HSP 1 Score: 80.9 bits (198), Expect = 5.1e-16 Identity = 39/96 (40.62%), Postives = 56/96 (58.33%), Query Frame = 1
BLAST of MELO3C026136 vs. TAIR10
Match: AT1G28010.1 (AT1G28010.1 P-glycoprotein 14) HSP 1 Score: 80.1 bits (196), Expect = 8.8e-16 Identity = 35/77 (45.45%), Postives = 50/77 (64.94%), Query Frame = 1
BLAST of MELO3C026136 vs. TAIR10
Match: AT1G27940.1 (AT1G27940.1 P-glycoprotein 13) HSP 1 Score: 75.9 bits (185), Expect = 1.7e-14 Identity = 33/77 (42.86%), Postives = 48/77 (62.34%), Query Frame = 1
BLAST of MELO3C026136 vs. TAIR10
Match: AT4G25960.1 (AT4G25960.1 P-glycoprotein 2) HSP 1 Score: 74.7 bits (182), Expect = 3.7e-14 Identity = 33/96 (34.38%), Postives = 54/96 (56.25%), Query Frame = 1
BLAST of MELO3C026136 vs. NCBI nr
Match: gi|778707234|ref|XP_004148691.2| (PREDICTED: ABC transporter B family member 19 [Cucumis sativus]) HSP 1 Score: 194.5 bits (493), Expect = 9.1e-47 Identity = 94/96 (97.92%), Postives = 94/96 (97.92%), Query Frame = 1
BLAST of MELO3C026136 vs. NCBI nr
Match: gi|700197275|gb|KGN52452.1| (Multidrug resistance protein 1, 2 [Cucumis sativus]) HSP 1 Score: 194.5 bits (493), Expect = 9.1e-47 Identity = 94/96 (97.92%), Postives = 94/96 (97.92%), Query Frame = 1
BLAST of MELO3C026136 vs. NCBI nr
Match: gi|659118790|ref|XP_008459308.1| (PREDICTED: ABC transporter B family member 19 [Cucumis melo]) HSP 1 Score: 194.5 bits (493), Expect = 9.1e-47 Identity = 94/96 (97.92%), Postives = 94/96 (97.92%), Query Frame = 1
BLAST of MELO3C026136 vs. NCBI nr
Match: gi|1021581457|ref|XP_016180100.1| (PREDICTED: ABC transporter B family member 19 [Arachis ipaensis]) HSP 1 Score: 191.4 bits (485), Expect = 7.7e-46 Identity = 91/96 (94.79%), Postives = 94/96 (97.92%), Query Frame = 1
BLAST of MELO3C026136 vs. NCBI nr
Match: gi|645249439|ref|XP_008230752.1| (PREDICTED: ABC transporter B family member 19 [Prunus mume]) HSP 1 Score: 189.9 bits (481), Expect = 2.2e-45 Identity = 91/96 (94.79%), Postives = 93/96 (96.88%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
This gene is associated with the following unigenes:
The following mRNA feature(s) are a part of this gene:
The following transcribed_cluster feature(s) are associated with this gene:
Analysis Name: InterPro Annotations of melon
Date Performed: 2016-09-28
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|