MELO3C026490 (gene) Melon (DHL92) v3.5.1
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGAGACTGCAAAGTGAGCCCCAAAGCACTGATCCAGAGCCACCTGAGTGTACAAGGAAAACTGTTCATTGTTTTTATATGATTTTGACTGCTTCTGATACTAGCACTCATGGAGGTTTCTCAGTTCTTAGAAAGCATGCCACTGAAAGTCTTCCTCCCTTTGTAAATCTTTCTACTATTACTATCATTTTTCTTCCATTTTTGTGGCTTCGTTTCTGAATGGTCGTTTCTTTTATTAAACATAGGATATAATTCAATCCACCCCAACTCAGGAGTTAGCTGCCAAGGATCTTCATGGTTACGAGCCAAAATTTAAGCATATTCTCAGGGGTACTTACTTCATTTTAAGTTATTTTAAGTATGTACATTCTTTAACTATTAACTTCTAG ATGAGACTGCAAAGTGAGCCCCAAAGCACTGATCCAGAGCCACCTGAGTGTACAAGGAAAACTGTTCATTGTTTTTATATGATTTTGACTGCTTCTGATACTAGCACTCATGGAGGTTTCTCAGTTCTTAGAAAGCATGCCACTGAAAGTCTTCCTCCCTTTGATATAATTCAATCCACCCCAACTCAGGAGTTAGCTGCCAAGGATCTTCATGGTTACGAGCCAAAATTTAAGCATATTCTCAGGGGTACTTACTTCATTTTAAGTTATTTTAAGTATGTACATTCTTTAACTATTAACTTCTAG ATGAGACTGCAAAGTGAGCCCCAAAGCACTGATCCAGAGCCACCTGAGTGTACAAGGAAAACTGTTCATTGTTTTTATATGATTTTGACTGCTTCTGATACTAGCACTCATGGAGGTTTCTCAGTTCTTAGAAAGCATGCCACTGAAAGTCTTCCTCCCTTTGATATAATTCAATCCACCCCAACTCAGGAGTTAGCTGCCAAGGATCTTCATGGTTACGAGCCAAAATTTAAGCATATTCTCAGGGGTACTTACTTCATTTTAAGTTATTTTAAGTATGTACATTCTTTAACTATTAACTTCTAG MRLQSEPQSTDPEPPECTRKTVHCFYMILTASDTSTHGGFSVLRKHATESLPPFDIIQSTPTQELAAKDLHGYEPKFKHILRGTYFILSYFKYVHSLTINF*
BLAST of MELO3C026490 vs. Swiss-Prot
Match: ARFI_ARATH (Auxin response factor 9 OS=Arabidopsis thaliana GN=ARF9 PE=1 SV=1) HSP 1 Score: 120.6 bits (301), Expect = 1.0e-26 Identity = 56/78 (71.79%), Postives = 59/78 (75.64%), Query Frame = 1
BLAST of MELO3C026490 vs. Swiss-Prot
Match: ARFK_ARATH (Auxin response factor 11 OS=Arabidopsis thaliana GN=ARF11 PE=2 SV=3) HSP 1 Score: 112.1 bits (279), Expect = 3.7e-24 Identity = 56/80 (70.00%), Postives = 58/80 (72.50%), Query Frame = 1
BLAST of MELO3C026490 vs. Swiss-Prot
Match: ARFR_ARATH (Auxin response factor 18 OS=Arabidopsis thaliana GN=ARF18 PE=2 SV=1) HSP 1 Score: 109.0 bits (271), Expect = 3.1e-23 Identity = 53/80 (66.25%), Postives = 58/80 (72.50%), Query Frame = 1
BLAST of MELO3C026490 vs. Swiss-Prot
Match: ARFA_ORYSJ (Auxin response factor 1 OS=Oryza sativa subsp. japonica GN=ARF1 PE=2 SV=1) HSP 1 Score: 101.7 bits (252), Expect = 5.0e-21 Identity = 50/77 (64.94%), Postives = 52/77 (67.53%), Query Frame = 1
BLAST of MELO3C026490 vs. Swiss-Prot
Match: ARFG_ORYSJ (Auxin response factor 7 OS=Oryza sativa subsp. japonica GN=ARF7 PE=2 SV=1) HSP 1 Score: 98.2 bits (243), Expect = 5.5e-20 Identity = 49/80 (61.25%), Postives = 54/80 (67.50%), Query Frame = 1
BLAST of MELO3C026490 vs. TrEMBL
Match: A0A0A0K887_CUCSA (Auxin response factor OS=Cucumis sativus GN=Csa_7G329330 PE=3 SV=1) HSP 1 Score: 139.8 bits (351), Expect = 1.8e-30 Identity = 68/80 (85.00%), Postives = 70/80 (87.50%), Query Frame = 1
BLAST of MELO3C026490 vs. TrEMBL
Match: A0A0B0MHY8_GOSAR (Auxin response factor OS=Gossypium arboreum GN=F383_21897 PE=3 SV=1) HSP 1 Score: 125.6 bits (314), Expect = 3.6e-26 Identity = 61/80 (76.25%), Postives = 66/80 (82.50%), Query Frame = 1
BLAST of MELO3C026490 vs. TrEMBL
Match: M5XS24_PRUPE (Auxin response factor OS=Prunus persica GN=PRUPE_ppa002230mg PE=3 SV=1) HSP 1 Score: 125.2 bits (313), Expect = 4.7e-26 Identity = 62/80 (77.50%), Postives = 66/80 (82.50%), Query Frame = 1
BLAST of MELO3C026490 vs. TrEMBL
Match: U5FPS3_POPTR (Auxin response factor OS=Populus trichocarpa GN=POPTR_0014s09560g PE=3 SV=1) HSP 1 Score: 124.0 bits (310), Expect = 1.0e-25 Identity = 59/80 (73.75%), Postives = 66/80 (82.50%), Query Frame = 1
BLAST of MELO3C026490 vs. TrEMBL
Match: U5FV32_POPTR (Auxin response factor OS=Populus trichocarpa GN=POPTR_0014s09560g PE=3 SV=1) HSP 1 Score: 124.0 bits (310), Expect = 1.0e-25 Identity = 59/80 (73.75%), Postives = 66/80 (82.50%), Query Frame = 1
BLAST of MELO3C026490 vs. TAIR10
Match: AT4G23980.1 (AT4G23980.1 auxin response factor 9) HSP 1 Score: 120.6 bits (301), Expect = 5.8e-28 Identity = 56/78 (71.79%), Postives = 59/78 (75.64%), Query Frame = 1
BLAST of MELO3C026490 vs. TAIR10
Match: AT2G46530.3 (AT2G46530.3 auxin response factor 11) HSP 1 Score: 112.1 bits (279), Expect = 2.1e-25 Identity = 56/80 (70.00%), Postives = 58/80 (72.50%), Query Frame = 1
BLAST of MELO3C026490 vs. TAIR10
Match: AT3G61830.1 (AT3G61830.1 auxin response factor 18) HSP 1 Score: 109.0 bits (271), Expect = 1.7e-24 Identity = 53/80 (66.25%), Postives = 58/80 (72.50%), Query Frame = 1
BLAST of MELO3C026490 vs. TAIR10
Match: AT1G59750.1 (AT1G59750.1 auxin response factor 1) HSP 1 Score: 94.0 bits (232), Expect = 5.8e-20 Identity = 48/80 (60.00%), Postives = 51/80 (63.75%), Query Frame = 1
BLAST of MELO3C026490 vs. TAIR10
Match: AT5G62000.1 (AT5G62000.1 auxin response factor 2) HSP 1 Score: 92.0 bits (227), Expect = 2.2e-19 Identity = 47/78 (60.26%), Postives = 52/78 (66.67%), Query Frame = 1
BLAST of MELO3C026490 vs. NCBI nr
Match: gi|449443756|ref|XP_004139643.1| (PREDICTED: auxin response factor 18 isoform X1 [Cucumis sativus]) HSP 1 Score: 139.8 bits (351), Expect = 2.6e-30 Identity = 68/80 (85.00%), Postives = 70/80 (87.50%), Query Frame = 1
BLAST of MELO3C026490 vs. NCBI nr
Match: gi|778726762|ref|XP_011659155.1| (PREDICTED: auxin response factor 18 isoform X2 [Cucumis sativus]) HSP 1 Score: 139.8 bits (351), Expect = 2.6e-30 Identity = 68/80 (85.00%), Postives = 70/80 (87.50%), Query Frame = 1
BLAST of MELO3C026490 vs. NCBI nr
Match: gi|659124359|ref|XP_008462117.1| (PREDICTED: auxin response factor 18-like [Cucumis melo]) HSP 1 Score: 135.6 bits (340), Expect = 4.9e-29 Identity = 66/80 (82.50%), Postives = 69/80 (86.25%), Query Frame = 1
BLAST of MELO3C026490 vs. NCBI nr
Match: gi|1009142516|ref|XP_015888764.1| (PREDICTED: auxin response factor 18 isoform X1 [Ziziphus jujuba]) HSP 1 Score: 128.3 bits (321), Expect = 7.9e-27 Identity = 62/80 (77.50%), Postives = 65/80 (81.25%), Query Frame = 1
BLAST of MELO3C026490 vs. NCBI nr
Match: gi|1009142518|ref|XP_015888765.1| (PREDICTED: auxin response factor 18 isoform X2 [Ziziphus jujuba]) HSP 1 Score: 128.3 bits (321), Expect = 7.9e-27 Identity = 62/80 (77.50%), Postives = 65/80 (81.25%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of melon
Date Performed: 2016-09-28
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|