MELO3C012884 (gene) Melon (DHL92) v3.5.1
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGAACCAGATGAGGAAACATATGATCTAGAGCATGAAGCTGATGAAATGGTGCCTGAACTTATTAATTTGTTAGGCGTGTCATCAGACGTCGATGACACGTTTGAGGATGATATTAAAGACACTGAGGAATTTTCAAAGCATGGTGAACATGAGAACTTAAACTCATGGAAACTTGCTAAACTAAGGGTGATTGCTAAATCTCGTAGTTTGAAAGGGTTTTCGAAGATGAAGAAGAGCAAGCTTATGCAATTGTTAAGCAAAGATCATTGA ATGGAACCAGATGAGGAAACATATGATCTAGAGCATGAAGCTGATGAAATGGTGCCTGAACTTATTAATTTGTTAGGCGTGTCATCAGACGTCGATGACACGTTTGAGGATGATATTAAAGACACTGAGGAATTTTCAAAGCATGGTGAACATGAGAACTTAAACTCATGGAAACTTGCTAAACTAAGGGTGATTGCTAAATCTCGTAGTTTGAAAGGGTTTTCGAAGATGAAGAAGAGCAAGCTTATGCAATTGTTAAGCAAAGATCATTGA ATGGAACCAGATGAGGAAACATATGATCTAGAGCATGAAGCTGATGAAATGGTGCCTGAACTTATTAATTTGTTAGGCGTGTCATCAGACGTCGATGACACGTTTGAGGATGATATTAAAGACACTGAGGAATTTTCAAAGCATGGTGAACATGAGAACTTAAACTCATGGAAACTTGCTAAACTAAGGGTGATTGCTAAATCTCGTAGTTTGAAAGGGTTTTCGAAGATGAAGAAGAGCAAGCTTATGCAATTGTTAAGCAAAGATCATTGA MEPDEETYDLEHEADEMVPELINLLGVSSDVDDTFEDDIKDTEEFSKHGEHENLNSWKLAKLRVIAKSRSLKGFSKMKKSKLMQLLSKDH*
BLAST of MELO3C012884 vs. Swiss-Prot
Match: RHON1_ARATH (Rho-N domain-containing protein 1, chloroplastic OS=Arabidopsis thaliana GN=RHON1 PE=1 SV=1) HSP 1 Score: 60.8 bits (146), Expect = 8.6e-09 Identity = 34/93 (36.56%), Postives = 59/93 (63.44%), Query Frame = 1
BLAST of MELO3C012884 vs. TrEMBL
Match: A0A0A0L7X8_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_3G384780 PE=4 SV=1) HSP 1 Score: 143.7 bits (361), Expect = 1.1e-31 Identity = 71/89 (79.78%), Postives = 81/89 (91.01%), Query Frame = 1
BLAST of MELO3C012884 vs. TrEMBL
Match: W9QWA9_9ROSA (SAP-like protein BP-73 OS=Morus notabilis GN=L484_001684 PE=4 SV=1) HSP 1 Score: 69.7 bits (169), Expect = 2.1e-09 Identity = 41/90 (45.56%), Postives = 62/90 (68.89%), Query Frame = 1
BLAST of MELO3C012884 vs. TrEMBL
Match: B9T1B2_RICCO (Putative uncharacterized protein OS=Ricinus communis GN=RCOM_0499370 PE=4 SV=1) HSP 1 Score: 65.5 bits (158), Expect = 3.9e-08 Identity = 44/92 (47.83%), Postives = 56/92 (60.87%), Query Frame = 1
BLAST of MELO3C012884 vs. TrEMBL
Match: D7KG06_ARALL (ATP binding protein OS=Arabidopsis lyrata subsp. lyrata GN=ARALYDRAFT_887819 PE=4 SV=1) HSP 1 Score: 64.3 bits (155), Expect = 8.7e-08 Identity = 36/89 (40.45%), Postives = 59/89 (66.29%), Query Frame = 1
BLAST of MELO3C012884 vs. TrEMBL
Match: A0A067K3Y6_JATCU (Uncharacterized protein OS=Jatropha curcas GN=JCGZ_17682 PE=4 SV=1) HSP 1 Score: 62.8 bits (151), Expect = 2.5e-07 Identity = 34/87 (39.08%), Postives = 55/87 (63.22%), Query Frame = 1
BLAST of MELO3C012884 vs. TAIR10
Match: AT1G06190.1 (AT1G06190.1 Rho termination factor) HSP 1 Score: 60.8 bits (146), Expect = 4.9e-10 Identity = 34/93 (36.56%), Postives = 59/93 (63.44%), Query Frame = 1
BLAST of MELO3C012884 vs. NCBI nr
Match: gi|659093204|ref|XP_008447422.1| (PREDICTED: rho-N domain-containing protein 1, chloroplastic isoform X5 [Cucumis melo]) HSP 1 Score: 157.5 bits (397), Expect = 1.1e-35 Identity = 76/90 (84.44%), Postives = 83/90 (92.22%), Query Frame = 1
BLAST of MELO3C012884 vs. NCBI nr
Match: gi|659093202|ref|XP_008447421.1| (PREDICTED: rho-N domain-containing protein 1, chloroplastic isoform X4 [Cucumis melo]) HSP 1 Score: 157.5 bits (397), Expect = 1.1e-35 Identity = 76/90 (84.44%), Postives = 83/90 (92.22%), Query Frame = 1
BLAST of MELO3C012884 vs. NCBI nr
Match: gi|659093200|ref|XP_008447419.1| (PREDICTED: rho-N domain-containing protein 1, chloroplastic isoform X3 [Cucumis melo]) HSP 1 Score: 157.5 bits (397), Expect = 1.1e-35 Identity = 76/90 (84.44%), Postives = 83/90 (92.22%), Query Frame = 1
BLAST of MELO3C012884 vs. NCBI nr
Match: gi|659093198|ref|XP_008447418.1| (PREDICTED: rho-N domain-containing protein 1, chloroplastic isoform X2 [Cucumis melo]) HSP 1 Score: 157.5 bits (397), Expect = 1.1e-35 Identity = 76/90 (84.44%), Postives = 83/90 (92.22%), Query Frame = 1
BLAST of MELO3C012884 vs. NCBI nr
Match: gi|659093196|ref|XP_008447417.1| (PREDICTED: rho-N domain-containing protein 1, chloroplastic isoform X1 [Cucumis melo]) HSP 1 Score: 157.5 bits (397), Expect = 1.1e-35 Identity = 76/90 (84.44%), Postives = 83/90 (92.22%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of melon
Date Performed: 2016-09-28
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene: |