MELO3C004340 (gene) Melon (DHL92) v3.5.1
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGAGGAGTTCAAATTACTTGGAGTCTAAAACCGTTTTGCTTCCTAATACATTCTTCAAATATGGAAATATGGTTAATCTGCCTACTAATGTTGATTGGAGAAAGGAAGGTGCAGTTACTCAGATAAAAAATCAAGGCCAATGTGGTACAAACTTGTAATACTCTCATTCATCCAACTAATCAGAAATATGTTGAACACATGTTCTCTTTACGTCTGATTTATGAGATTTTTTTTTTTCCTAACAAGTACCCTAAACCCTACCCTCTATCCTTTGTAAGTCATTTTGTCGTATTTGGAAAAATTTAGCAATCTTGAATTTTCAACACAAGGAGCTGTTAGGCATTCTCTGCAGTAGCAGCAGTCGAAGGCATCAACAAAATAAAAGCAGGGAAATTGATGTCTCTTTCAGAACAAAAGCTTGTAGACTGCGATGTGACCTCGGGGAACCAGGAATGCAGTGGTGGTTACATATACAAAGCATTAGAGTTCATAGCGGTGGTTACATATACAAAGCATTTGAGTTCATAGCGGTGGTTACATGTACAAAGCATTTGAGTTCATCAATAAAACTGGACTAACTACAAACAGAATATCCAT ATGAGGAGTTCAAATTACTTGGAGTCTAAAACCGTTTTGCTTCCTAATACATTCTTCAAATATGGAAATATGGTTAATCTGCCTACTAATGTTGATTGGAGAAAGGAAGGTGCAGTTACTCAGATAAAAAATCAAGGCCAATGTGTAGCAGCAGTCGAAGGCATCAACAAAATAAAAGCAGGGAAATTGATGTCTCTTTCAGAACAAAAGCTTGTAGACTGCGATGTGACCTCGGGGAACCAGGAATGCAGTGGTGGTTACATATACAAAGCATTAGAGTTCATAGCGGTGGTTACATATACAAAGCATTTGAGTTCATAGCGGTGGTTACATGTACAAAGCATTTGAGTTCATCAATAAAACTGGACTAACTACAAACAGAATATCCAT ATGAGGAGTTCAAATTACTTGGAGTCTAAAACCGTTTTGCTTCCTAATACATTCTTCAAATATGGAAATATGGTTAATCTGCCTACTAATGTTGATTGGAGAAAGGAAGGTGCAGTTACTCAGATAAAAAATCAAGGCCAATGTGTAGCAGCAGTCGAAGGCATCAACAAAATAAAAGCAGGGAAATTGATGTCTCTTTCAGAACAAAAGCTTGTAGACTGCGATGTGACCTCGGGGAACCAGGAATGCAGTGGTGGTTACATATACAAAGCATTAGAGTTCATAGCGGTGGTTACATATACAAAGCATTTGAGTTCATAG MRSSNYLESKTVLLPNTFFKYGNMVNLPTNVDWRKEGAVTQIKNQGQCVAAVEGINKIKAGKLMSLSEQKLVDCDVTSGNQECSGGYIYKALEFIAVVTYTKHLSS*
BLAST of MELO3C004340 vs. Swiss-Prot
Match: CEP2_ARATH (KDEL-tailed cysteine endopeptidase CEP2 OS=Arabidopsis thaliana GN=CEP2 PE=1 SV=1) HSP 1 Score: 95.9 bits (237), Expect = 2.9e-19 Identity = 50/85 (58.82%), Postives = 61/85 (71.76%), Query Frame = 1
BLAST of MELO3C004340 vs. Swiss-Prot
Match: CEP1_ARATH (KDEL-tailed cysteine endopeptidase CEP1 OS=Arabidopsis thaliana GN=CEP1 PE=1 SV=1) HSP 1 Score: 95.9 bits (237), Expect = 2.9e-19 Identity = 51/85 (60.00%), Postives = 58/85 (68.24%), Query Frame = 1
BLAST of MELO3C004340 vs. Swiss-Prot
Match: CEP3_ARATH (KDEL-tailed cysteine endopeptidase CEP3 OS=Arabidopsis thaliana GN=CEP3 PE=2 SV=1) HSP 1 Score: 93.6 bits (231), Expect = 1.4e-18 Identity = 48/85 (56.47%), Postives = 59/85 (69.41%), Query Frame = 1
BLAST of MELO3C004340 vs. Swiss-Prot
Match: CYSEP_PHAVU (Vignain OS=Phaseolus vulgaris PE=2 SV=2) HSP 1 Score: 92.0 bits (227), Expect = 4.1e-18 Identity = 48/88 (54.55%), Postives = 59/88 (67.05%), Query Frame = 1
BLAST of MELO3C004340 vs. Swiss-Prot
Match: CYSEP_RICCO (Vignain OS=Ricinus communis GN=CYSEP PE=1 SV=1) HSP 1 Score: 91.3 bits (225), Expect = 7.0e-18 Identity = 48/88 (54.55%), Postives = 58/88 (65.91%), Query Frame = 1
BLAST of MELO3C004340 vs. TrEMBL
Match: A0A0A0LJV6_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_2G292830 PE=3 SV=1) HSP 1 Score: 151.0 bits (380), Expect = 8.3e-34 Identity = 75/100 (75.00%), Postives = 84/100 (84.00%), Query Frame = 1
BLAST of MELO3C004340 vs. TrEMBL
Match: M5X1M2_PRUPE (Uncharacterized protein OS=Prunus persica GN=PRUPE_ppa023515mg PE=3 SV=1) HSP 1 Score: 111.7 bits (278), Expect = 5.6e-22 Identity = 57/89 (64.04%), Postives = 64/89 (71.91%), Query Frame = 1
BLAST of MELO3C004340 vs. TrEMBL
Match: V4U257_9ROSI (Uncharacterized protein OS=Citrus clementina GN=CICLE_v10015835mg PE=3 SV=1) HSP 1 Score: 109.4 bits (272), Expect = 2.8e-21 Identity = 54/82 (65.85%), Postives = 63/82 (76.83%), Query Frame = 1
BLAST of MELO3C004340 vs. TrEMBL
Match: W9RAD3_9ROSA (KDEL-tailed cysteine endopeptidase CEP2 OS=Morus notabilis GN=L484_001450 PE=3 SV=1) HSP 1 Score: 107.5 bits (267), Expect = 1.1e-20 Identity = 52/94 (55.32%), Postives = 69/94 (73.40%), Query Frame = 1
BLAST of MELO3C004340 vs. TrEMBL
Match: A0A067DRZ9_CITSI (Uncharacterized protein OS=Citrus sinensis GN=CISIN_1g041120mg PE=3 SV=1) HSP 1 Score: 107.5 bits (267), Expect = 1.1e-20 Identity = 53/82 (64.63%), Postives = 63/82 (76.83%), Query Frame = 1
BLAST of MELO3C004340 vs. TAIR10
Match: AT3G48340.1 (AT3G48340.1 Cysteine proteinases superfamily protein) HSP 1 Score: 95.9 bits (237), Expect = 1.6e-20 Identity = 50/85 (58.82%), Postives = 61/85 (71.76%), Query Frame = 1
BLAST of MELO3C004340 vs. TAIR10
Match: AT5G50260.1 (AT5G50260.1 Cysteine proteinases superfamily protein) HSP 1 Score: 95.9 bits (237), Expect = 1.6e-20 Identity = 51/85 (60.00%), Postives = 58/85 (68.24%), Query Frame = 1
BLAST of MELO3C004340 vs. TAIR10
Match: AT3G48350.1 (AT3G48350.1 Cysteine proteinases superfamily protein) HSP 1 Score: 93.6 bits (231), Expect = 8.0e-20 Identity = 48/85 (56.47%), Postives = 59/85 (69.41%), Query Frame = 1
BLAST of MELO3C004340 vs. TAIR10
Match: AT1G06260.1 (AT1G06260.1 Cysteine proteinases superfamily protein) HSP 1 Score: 92.4 bits (228), Expect = 1.8e-19 Identity = 46/78 (58.97%), Postives = 55/78 (70.51%), Query Frame = 1
BLAST of MELO3C004340 vs. TAIR10
Match: AT4G35350.1 (AT4G35350.1 xylem cysteine peptidase 1) HSP 1 Score: 88.6 bits (218), Expect = 2.6e-18 Identity = 45/89 (50.56%), Postives = 60/89 (67.42%), Query Frame = 1
BLAST of MELO3C004340 vs. NCBI nr
Match: gi|659117224|ref|XP_008458487.1| (PREDICTED: ervatamin-B-like [Cucumis melo]) HSP 1 Score: 152.1 bits (383), Expect = 5.4e-34 Identity = 80/111 (72.07%), Postives = 87/111 (78.38%), Query Frame = 1
BLAST of MELO3C004340 vs. NCBI nr
Match: gi|449460678|ref|XP_004148072.1| (PREDICTED: ervatamin-B-like [Cucumis sativus]) HSP 1 Score: 151.0 bits (380), Expect = 1.2e-33 Identity = 75/100 (75.00%), Postives = 84/100 (84.00%), Query Frame = 1
BLAST of MELO3C004340 vs. NCBI nr
Match: gi|700206934|gb|KGN62053.1| (hypothetical protein Csa_2G292830 [Cucumis sativus]) HSP 1 Score: 151.0 bits (380), Expect = 1.2e-33 Identity = 75/100 (75.00%), Postives = 84/100 (84.00%), Query Frame = 1
BLAST of MELO3C004340 vs. NCBI nr
Match: gi|778673988|ref|XP_011650102.1| (PREDICTED: LOW QUALITY PROTEIN: vignain [Cucumis sativus]) HSP 1 Score: 142.5 bits (358), Expect = 4.2e-31 Identity = 74/108 (68.52%), Postives = 80/108 (74.07%), Query Frame = 1
BLAST of MELO3C004340 vs. NCBI nr
Match: gi|645245974|ref|XP_008229136.1| (PREDICTED: zingipain-2 [Prunus mume]) HSP 1 Score: 112.5 bits (280), Expect = 4.7e-22 Identity = 58/101 (57.43%), Postives = 71/101 (70.30%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of melon
Date Performed: 2016-09-28
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|