MELO3C014899 (gene) Melon (DHL92) v3.5.1

NameMELO3C014899
Typegene
OrganismCucumis melo (Melon (DHL92) v3.5.1)
DescriptionSplicing factor U2af large subunit A
Locationchr6 : 22234829 .. 22235068 (+)
The following sequences are available for this feature:

Gene sequence (with intron)

Legend: CDS
Hold the cursor over a type above to highlight its positions in the sequence below.
ATGGCCCTTCGTGATGAAATCTCCAGAAAATTTTGTATATCACAGTCGCTCAATGTCGAAGAAGGGAGTGAACTCACATTGAACGAAGACAAAATCGGAAAGGAACCCTTCATCGCTCATGCCGATCAGAGAGGATTCTCGGTAACTTTCCCGGAAAATCAGAGCCAAAACAGAAAGAATACGATGGAAAATACTAGAGAAATCGTCGTTCTTCCAATTTTAAAACTAATAAAGAAATAA

mRNA sequence

ATGGCCCTTCGTGATGAAATCTCCAGAAAATTTTGTATATCACAGTCGCTCAATGTCGAAGAAGGGAGTGAACTCACATTGAACGAAGACAAAATCGGAAAGGAACCCTTCATCGCTCATGCCGATCAGAGAGGATTCTCGGTAACTTTCCCGGAAAATCAGAGCCAAAACAGAAAGAATACGATGGAAAATACTAGAGAAATCGTCGTTCTTCCAATTTTAAAACTAATAAAGAAATAA

Coding sequence (CDS)

ATGGCCCTTCGTGATGAAATCTCCAGAAAATTTTGTATATCACAGTCGCTCAATGTCGAAGAAGGGAGTGAACTCACATTGAACGAAGACAAAATCGGAAAGGAACCCTTCATCGCTCATGCCGATCAGAGAGGATTCTCGGTAACTTTCCCGGAAAATCAGAGCCAAAACAGAAAGAATACGATGGAAAATACTAGAGAAATCGTCGTTCTTCCAATTTTAAAACTAATAAAGAAATAA

Protein sequence

MALRDEISRKFCISQSLNVEEGSELTLNEDKIGKEPFIAHADQRGFSVTFPENQSQNRKNTMENTREIVVLPILKLIKK*
GO Assignments
This gene is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0008150 biological_process
cellular_component GO:0005575 cellular_component
molecular_function GO:0003674 molecular_function

The following mRNA feature(s) are a part of this gene:

Feature NameUnique NameType
MELO3C014899T1MELO3C014899T1mRNA


The following gene(s) are orthologous to this gene:

None

The following gene(s) are paralogous to this gene:

None

The following block(s) are covering this gene:
GeneOrganismBlock
MELO3C014899Cucurbita pepo (Zucchini)cpemeB582
MELO3C014899Cucurbita pepo (Zucchini)cpemeB640
MELO3C014899Bottle gourd (USVL1VR-Ls)lsimeB032
MELO3C014899Bottle gourd (USVL1VR-Ls)lsimeB421
MELO3C014899Bottle gourd (USVL1VR-Ls)lsimeB443
MELO3C014899Cucumber (Gy14) v2cgybmeB213
MELO3C014899Cucumber (Gy14) v2cgybmeB441
MELO3C014899Silver-seed gourdcarmeB0373
MELO3C014899Silver-seed gourdcarmeB0444
MELO3C014899Cucumber (Chinese Long) v3cucmeB084
MELO3C014899Cucumber (Chinese Long) v3cucmeB250
MELO3C014899Cucumber (Chinese Long) v3cucmeB513
MELO3C014899Watermelon (97103) v2mewmbB434
MELO3C014899Watermelon (97103) v2mewmbB446
MELO3C014899Watermelon (97103) v2mewmbB450
MELO3C014899Wax gourdmewgoB525
MELO3C014899Wax gourdmewgoB532
MELO3C014899Melon (DHL92) v3.5.1memeB053
MELO3C014899Melon (DHL92) v3.5.1memeB112
MELO3C014899Cucumber (Gy14) v1cgymeB037
MELO3C014899Cucumber (Gy14) v1cgymeB565
MELO3C014899Cucurbita maxima (Rimu)cmameB137
MELO3C014899Cucurbita maxima (Rimu)cmameB237
MELO3C014899Cucurbita maxima (Rimu)cmameB345
MELO3C014899Cucurbita moschata (Rifu)cmomeB129
MELO3C014899Cucurbita moschata (Rifu)cmomeB225
MELO3C014899Wild cucumber (PI 183967)cpimeB079
MELO3C014899Wild cucumber (PI 183967)cpimeB244
MELO3C014899Wild cucumber (PI 183967)cpimeB503
MELO3C014899Cucumber (Chinese Long) v2cumeB078
MELO3C014899Cucumber (Chinese Long) v2cumeB245
MELO3C014899Watermelon (Charleston Gray)mewcgB427
MELO3C014899Watermelon (Charleston Gray)mewcgB439
MELO3C014899Watermelon (Charleston Gray)mewcgB444
MELO3C014899Watermelon (97103) v1mewmB485
MELO3C014899Watermelon (97103) v1mewmB462
MELO3C014899Watermelon (97103) v1mewmB487