MELO3C019176 (gene) Melon (DHL92) v3.5.1
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGTGAGTGTAAAGTGGCAAAAAGAGTTGTTTCGTGATGTTGAAATTGATACCAGTCTGCCCCCATATTATTTGAAAGGCCAGTTGTTTAAACTCACCGGTGTGCCTCCTGAACGGCAGAAGATTATGATTAAGGGTTGTATACTAAAGGTTACTTGA ATGGTGAGTGTAAAGTGGCAAAAAGAGTTGTTTCGTGATGTTGAAATTGATACCAGTCTGCCCCCATATTATTTGAAAGGCCAGTTGTTTAAACTCACCGGTGTGCCTCCTGAACGGCAGAAGATTATGATTAAGGGTTGTATACTAAAGGTTACTTGA ATGGTGAGTGTAAAGTGGCAAAAAGAGTTGTTTCGTGATGTTGAAATTGATACCAGTCTGCCCCCATATTATTTGAAAGGCCAGTTGTTTAAACTCACCGGTGTGCCTCCTGAACGGCAGAAGATTATGATTAAGGGTTGTATACTAAAGGTTACTTGA MVSVKWQKELFRDVEIDTSLPPYYLKGQLFKLTGVPPERQKIMIKGCILKVT*
BLAST of MELO3C019176 vs. Swiss-Prot
Match: UBP6_ARATH (Ubiquitin carboxyl-terminal hydrolase 6 OS=Arabidopsis thaliana GN=UBP6 PE=1 SV=1) HSP 1 Score: 75.1 bits (183), Expect = 2.6e-13 Identity = 34/49 (69.39%), Postives = 38/49 (77.55%), Query Frame = 1
BLAST of MELO3C019176 vs. Swiss-Prot
Match: UBP7_ARATH (Ubiquitin carboxyl-terminal hydrolase 7 OS=Arabidopsis thaliana GN=UBP7 PE=1 SV=1) HSP 1 Score: 75.1 bits (183), Expect = 2.6e-13 Identity = 33/49 (67.35%), Postives = 39/49 (79.59%), Query Frame = 1
BLAST of MELO3C019176 vs. Swiss-Prot
Match: UBP14_BOVIN (Ubiquitin carboxyl-terminal hydrolase 14 OS=Bos taurus GN=USP14 PE=2 SV=3) HSP 1 Score: 61.2 bits (147), Expect = 3.9e-09 Identity = 29/49 (59.18%), Postives = 32/49 (65.31%), Query Frame = 1
BLAST of MELO3C019176 vs. Swiss-Prot
Match: UBP14_HUMAN (Ubiquitin carboxyl-terminal hydrolase 14 OS=Homo sapiens GN=USP14 PE=1 SV=3) HSP 1 Score: 61.2 bits (147), Expect = 3.9e-09 Identity = 29/49 (59.18%), Postives = 32/49 (65.31%), Query Frame = 1
BLAST of MELO3C019176 vs. Swiss-Prot
Match: UBP14_MOUSE (Ubiquitin carboxyl-terminal hydrolase 14 OS=Mus musculus GN=Usp14 PE=1 SV=3) HSP 1 Score: 61.2 bits (147), Expect = 3.9e-09 Identity = 29/49 (59.18%), Postives = 32/49 (65.31%), Query Frame = 1
BLAST of MELO3C019176 vs. TrEMBL
Match: A0A0A0K9N4_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_7G451940 PE=3 SV=1) HSP 1 Score: 92.8 bits (229), Expect = 1.3e-16 Identity = 44/49 (89.80%), Postives = 46/49 (93.88%), Query Frame = 1
BLAST of MELO3C019176 vs. TrEMBL
Match: A0A072TN68_MEDTR (Ubiquitin carboxyl-terminal hydrolase OS=Medicago truncatula GN=MTR_8g015660 PE=3 SV=1) HSP 1 Score: 84.7 bits (208), Expect = 3.6e-14 Identity = 40/50 (80.00%), Postives = 44/50 (88.00%), Query Frame = 1
BLAST of MELO3C019176 vs. TrEMBL
Match: G8A2S7_MEDTR (Ubiquitin carboxyl-terminal hydrolase OS=Medicago truncatula GN=MTR_138s0025 PE=3 SV=1) HSP 1 Score: 84.3 bits (207), Expect = 4.7e-14 Identity = 40/49 (81.63%), Postives = 43/49 (87.76%), Query Frame = 1
BLAST of MELO3C019176 vs. TrEMBL
Match: S8CD92_9LAMI (Ubiquitin carboxyl-terminal hydrolase (Fragment) OS=Genlisea aurea GN=M569_12379 PE=4 SV=1) HSP 1 Score: 82.8 bits (203), Expect = 1.4e-13 Identity = 40/49 (81.63%), Postives = 42/49 (85.71%), Query Frame = 1
BLAST of MELO3C019176 vs. TrEMBL
Match: I3STU8_MEDTR (Uncharacterized protein OS=Medicago truncatula PE=2 SV=1) HSP 1 Score: 82.4 bits (202), Expect = 1.8e-13 Identity = 39/49 (79.59%), Postives = 42/49 (85.71%), Query Frame = 1
BLAST of MELO3C019176 vs. TAIR10
Match: AT1G51710.1 (AT1G51710.1 ubiquitin-specific protease 6) HSP 1 Score: 75.1 bits (183), Expect = 1.5e-14 Identity = 34/49 (69.39%), Postives = 38/49 (77.55%), Query Frame = 1
BLAST of MELO3C019176 vs. TAIR10
Match: AT3G21280.1 (AT3G21280.1 ubiquitin-specific protease 7) HSP 1 Score: 75.1 bits (183), Expect = 1.5e-14 Identity = 33/49 (67.35%), Postives = 39/49 (79.59%), Query Frame = 1
BLAST of MELO3C019176 vs. NCBI nr
Match: gi|449447838|ref|XP_004141674.1| (PREDICTED: ubiquitin carboxyl-terminal hydrolase 6 [Cucumis sativus]) HSP 1 Score: 92.8 bits (229), Expect = 1.9e-16 Identity = 44/49 (89.80%), Postives = 46/49 (93.88%), Query Frame = 1
BLAST of MELO3C019176 vs. NCBI nr
Match: gi|659124828|ref|XP_008462369.1| (PREDICTED: ubiquitin carboxyl-terminal hydrolase 6 [Cucumis melo]) HSP 1 Score: 92.8 bits (229), Expect = 1.9e-16 Identity = 44/49 (89.80%), Postives = 46/49 (93.88%), Query Frame = 1
BLAST of MELO3C019176 vs. NCBI nr
Match: gi|922332540|ref|XP_013444261.1| (ubiquitin carboxyl-terminal hydrolase [Medicago truncatula]) HSP 1 Score: 84.7 bits (208), Expect = 5.2e-14 Identity = 40/50 (80.00%), Postives = 44/50 (88.00%), Query Frame = 1
BLAST of MELO3C019176 vs. NCBI nr
Match: gi|502156184|ref|XP_004510348.1| (PREDICTED: ubiquitin carboxyl-terminal hydrolase 6-like [Cicer arietinum]) HSP 1 Score: 84.3 bits (207), Expect = 6.8e-14 Identity = 40/49 (81.63%), Postives = 43/49 (87.76%), Query Frame = 1
BLAST of MELO3C019176 vs. NCBI nr
Match: gi|527191679|gb|EPS62411.1| (ubiquitin carboxyl-terminal hydrolase, partial [Genlisea aurea]) HSP 1 Score: 82.8 bits (203), Expect = 2.0e-13 Identity = 40/49 (81.63%), Postives = 42/49 (85.71%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of melon
Date Performed: 2016-09-28
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|