MELO3C020752T1 (mRNA) Melon (DHL92) v3.5.1
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGCTATCCTCAAGGTAAACAAACTCCCACAACCTACTGTCCTCAAACAAATCCTCAAACGTTGCTCTAGCCTTGGCAAAAAGTCCAACAACGGTGCCTACGATGCCGATGAAGAACTCCCTCTTGACGTCCCCAAGGGCCACTTCGCCGTCTACGTCGGCGAGAACAGAAGTCGTTACATCGTTCCGATCTCGTTCTTAACTCACCCGGAATTCCAATGCTTACTTCGTCAAGCGGAAGAAGAATTTGGATTTGATCATTACATGGGGCTCACTATTCCTTGCCAAGAGCATGTGTTTAGATCCTTAACCTCCTCCATGCTTAGATGA ATGGCTATCCTCAAGGTAAACAAACTCCCACAACCTACTGTCCTCAAACAAATCCTCAAACGTTGCTCTAGCCTTGGCAAAAAGTCCAACAACGGTGCCTACGATGCCGATGAAGAACTCCCTCTTGACGTCCCCAAGGGCCACTTCGCCGTCTACGTCGGCGAGAACAGAAGTCGTTACATCGTTCCGATCTCGTTCTTAACTCACCCGGAATTCCAATGCTTACTTCGTCAAGCGGAAGAAGAATTTGGATTTGATCATTACATGGGGCTCACTATTCCTTGCCAAGAGCATGTGTTTAGATCCTTAACCTCCTCCATGCTTAGATGA ATGGCTATCCTCAAGGTAAACAAACTCCCACAACCTACTGTCCTCAAACAAATCCTCAAACGTTGCTCTAGCCTTGGCAAAAAGTCCAACAACGGTGCCTACGATGCCGATGAAGAACTCCCTCTTGACGTCCCCAAGGGCCACTTCGCCGTCTACGTCGGCGAGAACAGAAGTCGTTACATCGTTCCGATCTCGTTCTTAACTCACCCGGAATTCCAATGCTTACTTCGTCAAGCGGAAGAAGAATTTGGATTTGATCATTACATGGGGCTCACTATTCCTTGCCAAGAGCATGTGTTTAGATCCTTAACCTCCTCCATGCTTAGATGA MAILKVNKLPQPTVLKQILKRCSSLGKKSNNGAYDADEELPLDVPKGHFAVYVGENRSRYIVPISFLTHPEFQCLLRQAEEEFGFDHYMGLTIPCQEHVFRSLTSSMLR*
BLAST of MELO3C020752T1 vs. Swiss-Prot
Match: ARG7_VIGRR (Indole-3-acetic acid-induced protein ARG7 OS=Vigna radiata var. radiata GN=ARG7 PE=2 SV=1) HSP 1 Score: 87.8 bits (216), Expect = 8.0e-17 Identity = 41/67 (61.19%), Postives = 49/67 (73.13%), Query Frame = 1
BLAST of MELO3C020752T1 vs. Swiss-Prot
Match: AX15A_SOYBN (Auxin-induced protein 15A OS=Glycine max PE=2 SV=1) HSP 1 Score: 87.4 bits (215), Expect = 1.0e-16 Identity = 40/66 (60.61%), Postives = 48/66 (72.73%), Query Frame = 1
BLAST of MELO3C020752T1 vs. Swiss-Prot
Match: AXX15_SOYBN (Auxin-induced protein X15 OS=Glycine max PE=2 SV=1) HSP 1 Score: 85.9 bits (211), Expect = 3.0e-16 Identity = 38/64 (59.38%), Postives = 47/64 (73.44%), Query Frame = 1
BLAST of MELO3C020752T1 vs. Swiss-Prot
Match: AX10A_SOYBN (Auxin-induced protein X10A OS=Glycine max PE=2 SV=1) HSP 1 Score: 82.4 bits (202), Expect = 3.4e-15 Identity = 37/67 (55.22%), Postives = 49/67 (73.13%), Query Frame = 1
BLAST of MELO3C020752T1 vs. Swiss-Prot
Match: A10A5_SOYBN (Auxin-induced protein 10A5 OS=Glycine max PE=2 SV=1) HSP 1 Score: 82.0 bits (201), Expect = 4.4e-15 Identity = 38/67 (56.72%), Postives = 49/67 (73.13%), Query Frame = 1
BLAST of MELO3C020752T1 vs. TrEMBL
Match: A0A0A0LJ77_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_2G258100 PE=4 SV=1) HSP 1 Score: 218.0 bits (554), Expect = 5.7e-54 Identity = 106/109 (97.25%), Postives = 107/109 (98.17%), Query Frame = 1
BLAST of MELO3C020752T1 vs. TrEMBL
Match: W9QZT5_9ROSA (Uncharacterized protein OS=Morus notabilis GN=L484_012234 PE=4 SV=1) HSP 1 Score: 176.0 bits (445), Expect = 2.5e-41 Identity = 93/109 (85.32%), Postives = 97/109 (88.99%), Query Frame = 1
BLAST of MELO3C020752T1 vs. TrEMBL
Match: K4B3S0_SOLLC (Uncharacterized protein OS=Solanum lycopersicum PE=4 SV=1) HSP 1 Score: 172.9 bits (437), Expect = 2.1e-40 Identity = 86/109 (78.90%), Postives = 97/109 (88.99%), Query Frame = 1
BLAST of MELO3C020752T1 vs. TrEMBL
Match: A0A0D2PZC4_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_005G249300 PE=4 SV=1) HSP 1 Score: 172.2 bits (435), Expect = 3.6e-40 Identity = 89/109 (81.65%), Postives = 95/109 (87.16%), Query Frame = 1
BLAST of MELO3C020752T1 vs. TrEMBL
Match: M0ZN14_SOLTU (Uncharacterized protein OS=Solanum tuberosum GN=PGSC0003DMG400001668 PE=4 SV=1) HSP 1 Score: 171.8 bits (434), Expect = 4.7e-40 Identity = 85/109 (77.98%), Postives = 97/109 (88.99%), Query Frame = 1
BLAST of MELO3C020752T1 vs. TAIR10
Match: AT4G34760.1 (AT4G34760.1 SAUR-like auxin-responsive protein family ) HSP 1 Score: 156.8 bits (395), Expect = 7.9e-39 Identity = 83/106 (78.30%), Postives = 88/106 (83.02%), Query Frame = 1
BLAST of MELO3C020752T1 vs. TAIR10
Match: AT1G75580.1 (AT1G75580.1 SAUR-like auxin-responsive protein family ) HSP 1 Score: 154.8 bits (390), Expect = 3.0e-38 Identity = 79/109 (72.48%), Postives = 87/109 (79.82%), Query Frame = 1
BLAST of MELO3C020752T1 vs. TAIR10
Match: AT1G19830.1 (AT1G19830.1 SAUR-like auxin-responsive protein family ) HSP 1 Score: 150.6 bits (379), Expect = 5.7e-37 Identity = 76/113 (67.26%), Postives = 87/113 (76.99%), Query Frame = 1
BLAST of MELO3C020752T1 vs. TAIR10
Match: AT2G16580.1 (AT2G16580.1 SAUR-like auxin-responsive protein family ) HSP 1 Score: 149.4 bits (376), Expect = 1.3e-36 Identity = 76/106 (71.70%), Postives = 86/106 (81.13%), Query Frame = 1
BLAST of MELO3C020752T1 vs. TAIR10
Match: AT2G21220.1 (AT2G21220.1 SAUR-like auxin-responsive protein family ) HSP 1 Score: 146.7 bits (369), Expect = 8.2e-36 Identity = 76/105 (72.38%), Postives = 84/105 (80.00%), Query Frame = 1
BLAST of MELO3C020752T1 vs. NCBI nr
Match: gi|659115572|ref|XP_008457621.1| (PREDICTED: auxin-induced protein 15A [Cucumis melo]) HSP 1 Score: 225.3 bits (573), Expect = 5.1e-56 Identity = 109/109 (100.00%), Postives = 109/109 (100.00%), Query Frame = 1
BLAST of MELO3C020752T1 vs. NCBI nr
Match: gi|449458540|ref|XP_004147005.1| (PREDICTED: auxin-induced protein 15A [Cucumis sativus]) HSP 1 Score: 218.0 bits (554), Expect = 8.2e-54 Identity = 106/109 (97.25%), Postives = 107/109 (98.17%), Query Frame = 1
BLAST of MELO3C020752T1 vs. NCBI nr
Match: gi|700206744|gb|KGN61863.1| (hypothetical protein Csa_2G258100 [Cucumis sativus]) HSP 1 Score: 218.0 bits (554), Expect = 8.2e-54 Identity = 106/109 (97.25%), Postives = 107/109 (98.17%), Query Frame = 1
BLAST of MELO3C020752T1 vs. NCBI nr
Match: gi|703095897|ref|XP_010095663.1| (hypothetical protein L484_012234 [Morus notabilis]) HSP 1 Score: 176.0 bits (445), Expect = 3.6e-41 Identity = 93/109 (85.32%), Postives = 97/109 (88.99%), Query Frame = 1
BLAST of MELO3C020752T1 vs. NCBI nr
Match: gi|460370303|ref|XP_004230993.1| (PREDICTED: auxin-induced protein 15A-like [Solanum lycopersicum]) HSP 1 Score: 172.9 bits (437), Expect = 3.0e-40 Identity = 86/109 (78.90%), Postives = 97/109 (88.99%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this mRNA:
GO Assignments
This mRNA is annotated with the following GO terms.
This mRNA is a part of the following gene feature(s):
The following polypeptide feature(s) derives from this mRNA:
The following CDS feature(s) are a part of this mRNA:
Analysis Name: InterPro Annotations of melon
Date Performed: 2016-09-28
|