Bhi09G000698 (gene) Wax gourd
The following sequences are available for this feature:
Legend: polypeptideexonCDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGTTCCTCGGTCGCTCGGGGCAGAGAATCGGACCGAGTGCAACATTCTTGCCGCCGATTCTAACTCTCTTGCATATACAAGAACGCCACAGGAGCTCTTGCGAATAGTTTATGAAACCGGCAACGAAGGTGTCCCTGGTGCATTTTTTCCCAATGGTTTGAATGGAAGAATTGCAAGAAGCTTCATTCGAAAAAGGGACTAA ATGGTTCCTCGGTCGCTCGGGGCAGAGAATCGGACCGAGTGCAACATTCTTGCCGCCGATTCTAACTCTCTTGCATATACAAGAACGCCACAGGAGCTCTTGCGAATAGTTTATGAAACCGGCAACGAAGGTGTCCCTGGTGCATTTTTTCCCAATGGTTTGAATGGAAGAATTGCAAGAAGCTTCATTCGAAAAAGGGACTAA ATGGTTCCTCGGTCGCTCGGGGCAGAGAATCGGACCGAGTGCAACATTCTTGCCGCCGATTCTAACTCTCTTGCATATACAAGAACGCCACAGGAGCTCTTGCGAATAGTTTATGAAACCGGCAACGAAGGTGTCCCTGGTGCATTTTTTCCCAATGGTTTGAATGGAAGAATTGCAAGAAGCTTCATTCGAAAAAGGGACTAA MVPRSLGAENRTECNILAADSNSLAYTRTPQELLRIVYETGNEGVPGAFFPNGLNGRIARSFIRKRD
BLAST of Bhi09G000698 vs. Swiss-Prot
Match: sp|P22242|DRPE_CRAPL (Desiccation-related protein PCC13-62 OS=Craterostigma plantagineum OX=4153 PE=2 SV=1) HSP 1 Score: 44.3 bits (103), Expect = 6.3e-04 Identity = 22/57 (38.60%), Postives = 28/57 (49.12%), Query Frame = 0
BLAST of Bhi09G000698 vs. TAIR10
Match: AT3G62730.1 (unknown protein) HSP 1 Score: 81.3 bits (199), Expect = 2.6e-16 Identity = 39/62 (62.90%), Postives = 47/62 (75.81%), Query Frame = 0
BLAST of Bhi09G000698 vs. TAIR10
Match: AT1G47980.1 (unknown protein) HSP 1 Score: 74.7 bits (182), Expect = 2.4e-14 Identity = 31/63 (49.21%), Postives = 47/63 (74.60%), Query Frame = 0
BLAST of Bhi09G000698 vs. TrEMBL
Match: tr|A0A1S4DZA6|A0A1S4DZA6_CUCME (desiccation-related protein PCC13-62-like OS=Cucumis melo OX=3656 GN=LOC107991160 PE=4 SV=1) HSP 1 Score: 106.3 bits (264), Expect = 2.7e-20 Identity = 51/67 (76.12%), Postives = 55/67 (82.09%), Query Frame = 0
BLAST of Bhi09G000698 vs. TrEMBL
Match: tr|K4CRQ8|K4CRQ8_SOLLC (Uncharacterized protein OS=Solanum lycopersicum OX=4081 GN=101252109 PE=4 SV=1) HSP 1 Score: 97.4 bits (241), Expect = 1.3e-17 Identity = 42/65 (64.62%), Postives = 55/65 (84.62%), Query Frame = 0
BLAST of Bhi09G000698 vs. TrEMBL
Match: tr|A0A0B0N4G5|A0A0B0N4G5_GOSAR (Desiccation-related PCC13-62 OS=Gossypium arboreum OX=29729 GN=F383_33869 PE=4 SV=1) HSP 1 Score: 96.7 bits (239), Expect = 2.2e-17 Identity = 43/63 (68.25%), Postives = 51/63 (80.95%), Query Frame = 0
BLAST of Bhi09G000698 vs. TrEMBL
Match: tr|A0A0D2P783|A0A0D2P783_GOSRA (Uncharacterized protein OS=Gossypium raimondii OX=29730 GN=B456_004G052900 PE=4 SV=1) HSP 1 Score: 96.7 bits (239), Expect = 2.2e-17 Identity = 43/63 (68.25%), Postives = 52/63 (82.54%), Query Frame = 0
BLAST of Bhi09G000698 vs. TrEMBL
Match: tr|A0A1U8NM68|A0A1U8NM68_GOSHI (desiccation-related protein PCC13-62-like OS=Gossypium hirsutum OX=3635 GN=LOC107949722 PE=4 SV=1) HSP 1 Score: 95.5 bits (236), Expect = 4.8e-17 Identity = 43/63 (68.25%), Postives = 51/63 (80.95%), Query Frame = 0
BLAST of Bhi09G000698 vs. NCBI nr
Match: XP_016901050.1 (PREDICTED: desiccation-related protein PCC13-62-like [Cucumis melo]) HSP 1 Score: 106.3 bits (264), Expect = 4.1e-20 Identity = 51/67 (76.12%), Postives = 55/67 (82.09%), Query Frame = 0
BLAST of Bhi09G000698 vs. NCBI nr
Match: XP_022960201.1 (desiccation-related protein PCC13-62-like [Cucurbita moschata]) HSP 1 Score: 98.2 bits (243), Expect = 1.1e-17 Identity = 45/64 (70.31%), Postives = 54/64 (84.38%), Query Frame = 0
BLAST of Bhi09G000698 vs. NCBI nr
Match: XP_023515237.1 (desiccation-related protein PCC13-62-like [Cucurbita pepo subsp. pepo]) HSP 1 Score: 98.2 bits (243), Expect = 1.1e-17 Identity = 45/64 (70.31%), Postives = 54/64 (84.38%), Query Frame = 0
BLAST of Bhi09G000698 vs. NCBI nr
Match: XP_004246335.2 (desiccation-related protein PCC13-62-like [Solanum lycopersicum]) HSP 1 Score: 97.4 bits (241), Expect = 1.9e-17 Identity = 42/65 (64.62%), Postives = 55/65 (84.62%), Query Frame = 0
BLAST of Bhi09G000698 vs. NCBI nr
Match: KHG06739.1 (Desiccation-related PCC13-62 [Gossypium arboreum]) HSP 1 Score: 96.7 bits (239), Expect = 3.3e-17 Identity = 43/63 (68.25%), Postives = 51/63 (80.95%), Query Frame = 0
The following BLAST results are available for this feature:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of wax gourd
Date Performed: 2019-11-17
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|