Bhi10G001737 (gene) Wax gourd
The following sequences are available for this feature:
Legend: polypeptideCDSexon Hold the cursor over a type above to highlight its positions in the sequence below.ATGAGAGAGAAACTCAGAGGAAAAAACACGTTCTCTCTTTGCGAGGTCCGAAAGTGGAGAACGCATAGCATTCTCTGGGCACATAGGATTAAACGTAAAGCTGCGCTTTCTTGGCGGAGTTTTAGGCGGCAAGAGACTTTAGGGCTTGTTGGAGGTGCTGAGCATAACGAATCGAAACCAGAGACGGATCAAGGTAGCTTACCTGCCAAGCCGATAGGCGAAGGGCCGAAGGATGGAGCGTGCAAAGTCAATCGTGCACCTGTCGTGTGA ATGAGAGAGAAACTCAGAGGAAAAAACACGTTCTCTCTTTGCGAGGTCCGAAAGTGGAGAACGCATAGCATTCTCTGGGCACATAGGATTAAACGTAAAGCTGCGCTTTCTTGGCGGAGTTTTAGGCGGCAAGAGACTTTAGGGCTTGTTGGAGGTGCTGAGCATAACGAATCGAAACCAGAGACGGATCAAGGTAGCTTACCTGCCAAGCCGATAGGCGAAGGGCCGAAGGATGGAGCGTGCAAAGTCAATCGTGCACCTGTCGTGTGA ATGAGAGAGAAACTCAGAGGAAAAAACACGTTCTCTCTTTGCGAGGTCCGAAAGTGGAGAACGCATAGCATTCTCTGGGCACATAGGATTAAACGTAAAGCTGCGCTTTCTTGGCGGAGTTTTAGGCGGCAAGAGACTTTAGGGCTTGTTGGAGGTGCTGAGCATAACGAATCGAAACCAGAGACGGATCAAGGTAGCTTACCTGCCAAGCCGATAGGCGAAGGGCCGAAGGATGGAGCGTGCAAAGTCAATCGTGCACCTGTCGTGTGA MREKLRGKNTFSLCEVRKWRTHSILWAHRIKRKAALSWRSFRRQETLGLVGGAEHNESKPETDQGSLPAKPIGEGPKDGACKVNRAPVV
BLAST of Bhi10G001737 vs. TAIR10
Match: ATMG00560.1 (Nucleic acid-binding, OB-fold-like protein) HSP 1 Score: 138.3 bits (347), Expect = 2.3e-33 Identity = 70/99 (70.71%), Postives = 80/99 (80.81%), Query Frame = 0
BLAST of Bhi10G001737 vs. TAIR10
Match: AT2G07715.1 (Nucleic acid-binding, OB-fold-like protein) HSP 1 Score: 130.6 bits (327), Expect = 4.9e-31 Identity = 66/95 (69.47%), Postives = 76/95 (80.00%), Query Frame = 0
BLAST of Bhi10G001737 vs. Swiss-Prot
Match: sp|P93311|RM02_ARATH (60S ribosomal protein L2, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=RPL2 PE=3 SV=1) HSP 1 Score: 138.3 bits (347), Expect = 4.2e-32 Identity = 70/99 (70.71%), Postives = 80/99 (80.81%), Query Frame = 0
BLAST of Bhi10G001737 vs. Swiss-Prot
Match: sp|P0C8K6|RM02_ORYSA (60S ribosomal protein L2, mitochondrial OS=Oryza sativa OX=4530 GN=RPL2 PE=3 SV=1) HSP 1 Score: 124.0 bits (310), Expect = 8.3e-28 Identity = 71/128 (55.47%), Postives = 78/128 (60.94%), Query Frame = 0
BLAST of Bhi10G001737 vs. Swiss-Prot
Match: sp|Q2F969|RM02_ORYSI (60S ribosomal protein L2, mitochondrial OS=Oryza sativa subsp. indica OX=39946 GN=RPL2 PE=3 SV=2) HSP 1 Score: 124.0 bits (310), Expect = 8.3e-28 Identity = 71/128 (55.47%), Postives = 78/128 (60.94%), Query Frame = 0
BLAST of Bhi10G001737 vs. Swiss-Prot
Match: sp|P92812|RM02_ORYSJ (60S ribosomal protein L2, mitochondrial OS=Oryza sativa subsp. japonica OX=39947 GN=RPL2 PE=2 SV=2) HSP 1 Score: 124.0 bits (310), Expect = 8.3e-28 Identity = 71/128 (55.47%), Postives = 78/128 (60.94%), Query Frame = 0
BLAST of Bhi10G001737 vs. TrEMBL
Match: tr|D5I399|D5I399_CITLA (Ribosomal protein L2 OS=Citrullus lanatus OX=3654 GN=rpl2 PE=4 SV=1) HSP 1 Score: 183.0 bits (463), Expect = 3.0e-43 Identity = 87/88 (98.86%), Postives = 88/88 (100.00%), Query Frame = 0
BLAST of Bhi10G001737 vs. TrEMBL
Match: tr|A0A200Q8E8|A0A200Q8E8_9MAGN (Ribosomal protein L2 OS=Macleaya cordata OX=56857 GN=BVC80_6573g1 PE=4 SV=1) HSP 1 Score: 178.3 bits (451), Expect = 7.5e-42 Identity = 85/89 (95.51%), Postives = 88/89 (98.88%), Query Frame = 0
BLAST of Bhi10G001737 vs. TrEMBL
Match: tr|A0A1B0THG8|A0A1B0THG8_NELNU (Ribosomal protein L2 OS=Nelumbo nucifera OX=4432 GN=rpl2 PE=4 SV=1) HSP 1 Score: 175.6 bits (444), Expect = 4.8e-41 Identity = 83/88 (94.32%), Postives = 87/88 (98.86%), Query Frame = 0
BLAST of Bhi10G001737 vs. TrEMBL
Match: tr|A0A0M3ULW5|A0A0M3ULW5_CANSA (Ribosomal protein L2 OS=Cannabis sativa OX=3483 GN=rpl2 PE=4 SV=1) HSP 1 Score: 173.7 bits (439), Expect = 1.8e-40 Identity = 83/88 (94.32%), Postives = 86/88 (97.73%), Query Frame = 0
BLAST of Bhi10G001737 vs. TrEMBL
Match: tr|D5I3E9|D5I3E9_CUCPE (Ribosomal protein L2 OS=Cucurbita pepo OX=3663 GN=rpl2 PE=4 SV=1) HSP 1 Score: 171.0 bits (432), Expect = 1.2e-39 Identity = 81/88 (92.05%), Postives = 84/88 (95.45%), Query Frame = 0
BLAST of Bhi10G001737 vs. NCBI nr
Match: YP_003587229.1 (ribosomal protein L2 [Citrullus lanatus] >ACV96645.1 ribosomal protein L2 (mitochondrion) [Citrullus lanatus]) HSP 1 Score: 183.0 bits (463), Expect = 4.6e-43 Identity = 87/88 (98.86%), Postives = 88/88 (100.00%), Query Frame = 0
BLAST of Bhi10G001737 vs. NCBI nr
Match: OVA06704.1 (Ribosomal protein L2 [Macleaya cordata]) HSP 1 Score: 178.3 bits (451), Expect = 1.1e-41 Identity = 85/89 (95.51%), Postives = 88/89 (98.88%), Query Frame = 0
BLAST of Bhi10G001737 vs. NCBI nr
Match: YP_009270682.1 (ribosomal protein L2 (mitochondrion) [Nelumbo nucifera] >ALL55135.1 ribosomal protein L2 (mitochondrion) [Nelumbo nucifera]) HSP 1 Score: 175.6 bits (444), Expect = 7.3e-41 Identity = 83/88 (94.32%), Postives = 87/88 (98.86%), Query Frame = 0
BLAST of Bhi10G001737 vs. NCBI nr
Match: YP_009243674.1 (ribosomal protein L2 (mitochondrion) [Cannabis sativa] >ALF04062.1 ribosomal protein L2 (mitochondrion) [Cannabis sativa] >AMR97549.1 ribosomal protein L2 (mitochondrion) [Cannabis sativa] >ANC49131.1 ribosomal protein L2 (mitochondrion) [Cannabis sativa]) HSP 1 Score: 173.7 bits (439), Expect = 2.8e-40 Identity = 83/88 (94.32%), Postives = 86/88 (97.73%), Query Frame = 0
BLAST of Bhi10G001737 vs. NCBI nr
Match: YP_003587363.1 (ribosomal protein L2 [Cucurbita pepo] >ACV96687.1 ribosomal protein L2 (mitochondrion) [Cucurbita pepo]) HSP 1 Score: 171.0 bits (432), Expect = 1.8e-39 Identity = 81/88 (92.05%), Postives = 84/88 (95.45%), Query Frame = 0
The following BLAST results are available for this feature:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of wax gourd
Date Performed: 2019-11-17
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|